Recombinant human BAFF-R protein (Fc Chimera) (ab83931)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant human BAFF-R protein (Fc Chimera)
See all BAFF-R proteins and peptides -
Biological activity
The ED50 of BAFF Receptor – Fc Chimera is typically 0.02-0.08 μg/ml as measured by its ability to neutralize BAFF-mediated proliferation of the RPMI 8226 cell line.
-
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical Sequence: SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTA LQPQESVGAGAGEAALPGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK -
Additional sequence information
A fusion of the signal peptide of human GH receptor to the extracellular domain of human BAFF-R (aa 2-73), and the Fc region of human IgG1 (aa 93-330), expressed in modified human 293 cells.
-
Specifications
Our Abpromise guarantee covers the use of ab83931 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
Constituents: 10% Trehalose, 1% Human serum albumin
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
General Info
-
Alternative names
- B cell activating factor receptor
- B-cell-activating factor receptor
- BAFF R
see all -
Function
B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response. -
Tissue specificity
Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes. -
Involvement in disease
Defects in TNFRSF13C are the cause of immunodeficiency common variable type 4 (CVID4) [MIM:613494]; also called antibody deficiency due to BAFFR defect. CVID4 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low. -
Sequence similarities
Contains 1 TNFR-Cys repeat. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Lane 1 – MW markers; Lane 2 – ab83931; Lane 3 – ab83931 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83931 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 3 μg of protein was loaded per lane. Gels were stained with Coomassie G250.
Drop in MW after treatment with PNGase F indicates the presence of N-linked glycans. A subsequent drop in MW after treatment with a glycosidase cocktail indicates O-linked glycans are also present. Additional high MW bands in lane 4 are glycosidase enzymes. -
A sample of ab83931 without carrier protein was reduced and alkylated. 40 μg of protein was loaded, focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Spot train (Deep Purple™ stained) indicates presence of multiple glycoforms of BAFF Receptor - Fc Chimera. Spots within the spot train were cut from the gel and identified by protein mass fingerprinting as BAFF Receptor - Fc Chimera.
-
Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple glycoforms, which differ according to their level of post-translational modification.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab83931 has not yet been referenced specifically in any publications.