Recombinant Human IFN gamma Receptor beta/AF-1 protein (Fc Chimera) (ab83988)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human IFN gamma Receptor beta/AF-1 protein (Fc Chimera)
See all IFN gamma Receptor beta/AF-1 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical sequence: SQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYRVQFKYTDSKWF TADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALH SAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTA FFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWN KSNIFRVGHLSNISCYETMADASTELQQGSSNTKVDKKVEPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK -
Amino acids
28 to 247 -
Additional sequence information
DNA encoding the signal peptide and extracellular domain of human IFN-gamma R2 (aa 1-247) chain was fused to the Fc region of human IgG1 (aa 93-330). Protein expressed in modified human 293 cells.
-
Specifications
Our Abpromise guarantee covers the use of ab83988 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Previously labelled as IFN gamma Receptor beta.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C.
Constituents: 1% Human serum albumin, 10% Trehalose
-
ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
General Info
-
Alternative names
- AF 1
- AF-1
- AF1
see all -
Function
Part of the receptor for interferon gamma. Required for signal transduction. This accessory factor is an integral part of the IFN-gamma signal transduction pathway and is likely to interact with GAF, JAK1, and/or JAK2. -
Involvement in disease
Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD) [MIM:209950]; also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity, whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. -
Sequence similarities
Belongs to the type II cytokine receptor family.
Contains 2 fibronectin type-III domains. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Lane 1 – ab83988; Lane 2 – ab83988 treated with PNGase F to remove potential N-linked glycans; Lane 3 – ab83988 treated with a glycosidase cocktail to remove potential N- and O-linked glycans; Lane 4 – MW markers. 10 μg of protein was loaded per lane; Gel was stained with Coomassie G250.
Drop in MW after treatment with PNGase F indicates the presence of N-linked glycans. Faint bands in lane 2 and lane 3 are glycosidase enzymes. -
Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple glycoforms, which differ according to their level of post-translational modification.
The triangle indicates theoretical pI and MW of the protein.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab83988 has not yet been referenced specifically in any publications.