Recombinant human Cripto1/CRIPTO protein (ab84064)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant human Cripto1/CRIPTO protein
See all Cripto1/CRIPTO proteins and peptides -
Biological activity
ab84064 has been shown to stimulate MAPK phosphorylation in HUVEC cells. 200ng/ml is sufficient to stimulate phosphorylation. -
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical sequence: LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPP MGIQHSKELN RTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGS VPHDTWLPKKC SLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPE LPPS -
Amino acids
31 to 169
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab84064 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
ab84064 has been shown to stimulate MAPK phosphorylation in HUVEC cells. 200ng/ml is sufficient to stimulate phosphorylation.This product was previously labelled as Cripto1
This product was previously labelled as Cripto1
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
Constituents: 1% Human serum albumin, 10% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term sto rage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
General Info
-
Alternative names
- CR
- CRGF
- cripto
see all -
Function
Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm. -
Tissue specificity
Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. -
Sequence similarities
Contains 1 EGF-like domain. -
Cellular localization
Cell membrane. - Information by UniProt
Images
-
Lane 1- MW markers; Lane 2- ab84064 ; Lane 3- ab84064 treated with PNGase F to remove potential N-linked glycans; Lane 4- ab84064 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 μg of protein was loaded per lane; Gel was stained using Coomassie.
A drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.
O-fucosylation at Thr-88 has been confirmed.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab84064 has not yet been referenced specifically in any publications.