Recombinant human VEGF 121B protein (ab88348)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human VEGF 121B protein
See all VEGF 121B proteins and peptides -
Biological activity
Activity: The ED50 of VEGF 121B is typically 0.5-2.5 ng/ml as measured in a cell proliferation assay using human umbilical vein endothelial (HUVEC) cells.
-
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFK PSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSF LQHNKCECRPKKDRARQEKCDKPRR
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab88348 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C.
Constituents: 1% Human serum albumin, 10% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
General Info
-
Alternative names
- MVCD1
- Vascular endothelial growth factor A
- Vascular permeability factor
see all -
Relevance
VEGFA is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis, and induces permeabilization of blood vessels. Binds to the VEGFR1/Flt-1 and VEGFR2/Kdr receptors, heparan sulfate and heparin. Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. In contrast to other factors mitogenic for endothelial cells such as FGF-1, FGF-2 and PDGF, VEGF is synthesized as a precursor containing a typical hydrophobic secretory signal sequence of 26 amino acids. Glycosylation is not required for efficient secretion of VEGF. VEGF 121 circulates more freely than other VEGF forms, which bind more tightly with vascular heparin sulfates. -
Cellular localization
Secreted
Images
-
1D SDS-PAGE of ab88348 before and after treatment with glycosidases to remove oligosaccharides.
Lane 1: ab88348
Lane 2: ab88348 treated with PNGase F to remove potential N-linked glycans
Lane 3: ab88348 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. The absence of a drop in MWt after treatment with PNGase F indicates that there are no N-linked glycans attached to the protein. A subsequent drop in MWt after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes. -
A sample of ab88348 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Approximately 40 μg of protein was load. Multiple spot trains indicate the presence of multiple isoforms of ab88348. Spots within both spot trains were cut from the gel and identified as ab88348 by protein mass fingerprinting.
-
Densitometry of protein isoforms visualised by 2-DE.
The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
The triangle indicates the theoretical MWt and pI of the protein.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab88348 has not yet been referenced specifically in any publications.