Anti-GPCR GPR119 antibody (ab75312)
Key features and details
- Rabbit polyclonal to GPCR GPR119
- Suitable for: ELISA, IHC-Fr, IHC-P, WB, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-GPCR GPR119 antibody
See all GPCR GPR119 primary antibodies -
Description
Rabbit polyclonal to GPCR GPR119 -
Host species
Rabbit -
Tested applications
Suitable for: ELISA, IHC-Fr, IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide:
KMEHAGAMAGGYRSPRTPSDFKALRTVSVL
, corresponding to internal sequence amino acids 201-230 of Human GPCR GPR119 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 0.87% Sodium chloride, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab75312 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ELISA |
Use at an assay dependent concentration.
|
|
IHC-Fr | (1) |
Use at an assay dependent concentration.
|
IHC-P | (1) |
Use at an assay dependent concentration.
|
WB |
1/500 - 1/1000. Predicted molecular weight: 37 kDa.
|
|
ICC/IF |
1/500 - 1/1000.
|
Notes |
---|
ELISA
Use at an assay dependent concentration. |
IHC-Fr
Use at an assay dependent concentration. |
IHC-P
Use at an assay dependent concentration. |
WB
1/500 - 1/1000. Predicted molecular weight: 37 kDa. |
ICC/IF
1/500 - 1/1000. |
Target
-
Function
Receptor for the endogenous fatty-acid ethanolamide oleoylethanolamide (OEA) and lysophosphatidylcholine (LPC). Functions as a glucose-dependent insulinotropic receptor. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Seems to act through a G(s) mediated pathway. -
Tissue specificity
Predominantly expressed in the pancreas, especially in the islets. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 139760 Human
- Entrez Gene: 236781 Mouse
- Omim: 300513 Human
- SwissProt: Q8TDV5 Human
- SwissProt: Q7TQP3 Mouse
- Unigene: 496762 Human
- Unigene: 269129 Mouse
-
Alternative names
- G protein coupled receptor 119 antibody
- G protein coupled receptor 2 antibody
- G-protein coupled receptor 119 antibody
see all
Images
-
All lanes : Anti-GPCR GPR119 antibody (ab75312) at 1/500 dilution
Lane 1 : extracts from K562 cells
Lane 2 : extracts from K562 cells with immunising peptide at 10 µg
Lysates/proteins at 30 µg per lane.
Predicted band size: 37 kDa
Observed band size: 37 kDa
Additional bands at: 28 kDa, 60 kDa. We are unsure as to the identity of these extra bands. -
Left panel: immunofluorescence analysis of MCF-7 cells, using 1/500 ab75312. Right panel: same, after pre-incubation with the immunizing peptide.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab75312 has been referenced in 2 publications.
- Markovics A et al. GPR119 Is a Potent Regulator of Human Sebocyte Biology. J Invest Dermatol 140:1909-1918.e8 (2020). PubMed: 32142797
- Little TJ et al. Characterization of duodenal expression and localization of fatty acid-sensing receptors in humans: relationships with body mass index. Am J Physiol Gastrointest Liver Physiol 307:G958-67 (2014). PubMed: 25258406