Overview

  • Product name
  • Description
    Rabbit polyclonal to ING3
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human ING3 aa 1-92. Isoform 2
    Sequence:

    MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNA KKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF


    Database link: Q9NXR8-2

  • Positive control
    • 293T, SW620, HeLa and Rat testis cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab189861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 47 kDa.
ICC/IF Use at an assay dependent concentration.

Target

  • Relevance
    Function: Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome. Tissue specificity: Expressed in brain, heart, kidney, liver, lung, ovaries, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Disease: Squamous cell carcinoma of the head and neck Similarity: Belongs to the ING family. Contains 1 PHD-type zinc finger. Domain: The PHD-type zinc finger mediates the binding to H3K4me3.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • 1300013A07Rik antibody
    • Eaf 4 antibody
    • Eaf4 antibody
    • FLJ20089 antibody
    • ING 2 antibody
    • ING 3 antibody
    • ING2 antibody
    • ING3 antibody
    • ING3_HUMAN antibody
    • Inhibitor of growth family member 3 antibody
    • Inhibitor of growth protein 3 antibody
    • MEAF4 antibody
    • p47 ING 3 antibody
    • p47 ING3 antibody
    • p47 regulator protein antibody
    • p47ING3 antibody
    • p47ING3 protein antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of A549 cells using ab189861. Blue DAPI for nuclear staining.
  • All lanes : Anti-ING3 antibody (ab189861) at 1/500 dilution

    Lane 1 : 293T cell extracts
    Lane 2 : SW620 cell extracts
    Lane 3 : HeLa cell extracts
    Lane 4 : Rat testis cell extracts


    Predicted band size : 47 kDa

References

ab189861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up