Overview

  • Product name
    Anti-Inhibin alpha antibody
    See all Inhibin alpha primary antibodies
  • Description
    Rabbit polyclonal to Inhibin alpha
  • Tested applications
    Suitable for: WB, ELISA, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Goat, Horse, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 109-158 (

    LFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSP

    ) of Human Inhibin alpha (NP_002182)

  • Positive control
    • Human fetal liver lysate. This antibody gave a positive result when used in the following formaldehyde fixed cell lines: MCF-7

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81234 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/1562500.

ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
  • Tissue specificity
    Originally found in ovary (granulosa cells) and testis (Sertoli cells), but widely distributed in many tissues including brain and placenta. In adrenal cortex expression is limited to the zona reticularis and the innermost zona fasciculata in the normal gland, extending centripetally into the zona fasciculata in hyperplasia. Also found in adrenocortical tumors. Also expressed in prostate epithelium of benign prostatic hyperplasia, in regions of basal cell hyperplasia and in nonmalignant regions of high grade prostate cancer. Only circulating inhibin B is found in male, whereas circulating inhibins A and B are found in female.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Post-translational
    modifications
    Proteolytic processing yields a number of bioactive forms. The 20/23 kDa forms consist solely of the mature alpha chain, the 26/29 kDa forms consist of the most N-terminal propeptide linked through a disulfide bond to the mature alpha chain, the 50/53 kDa forms encompass the entire proprotein. Each type can be furthermore either mono- or diglycosylated, causing the mass difference.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • A inhibin subunit antibody
    • A inhibin subunit precursor antibody
    • AW55578 antibody
    • IHA antibody
    • inhA antibody
    • INHA_HUMAN antibody
    • Inhibin alpha chain antibody
    • Inhibin alpha chain precursor antibody
    • Inhibin alpha subunit antibody
    see all

Images

  • ICC/IF image of ab81234 stained MCF-7 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody ab81234 at 10µg/ml overnight at +4°C. The secondary antibody (pseudo-colored green) was Alexa Fluor® 488 goat anti- rabbit (ab150081) IgG (H+L) preadsorbed, used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (pseudo-colored red) at a 1/200 dilution for 1h at room temperature. DAPI was used to stain the cell nuclei (pseudo-colored blue) at a concentration of 1.43µM for 1hour at room temperature.

  • Anti-Inhibin alpha antibody (ab81234) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 40 kDa
    Observed band size : 39 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 48 kDa. We are unsure as to the identity of these extra bands.Gel concentration: 12%

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Blocking step
Odyssey Blocking Buffer as blocking agent for 3 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 26°C
Sample
Human Cell (COV434 cell line)
Specification
COV434 cell line
Permeabilization
Yes - Ethanol
Fixative
Formaldehyde
Username

Dr. Francesco Elia Marino

Verified customer

Submitted May 30 2014

Application
Western blot
Loading amount
60 µg
Gel Running Conditions
Reduced Non-Denaturing (Native) (12)
Sample
Human Cell lysate - whole cell (COV434 cell pellet)
Specification
COV434 cell pellet
Blocking step
Odyssey Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 26°C
Username

Dr. Francesco Elia Marino

Verified customer

Submitted Mar 12 2014

Thank you for your enquiry and your interest in our products. Unit size, price, availability, tested applications and species can be found on the on-line datasheets: http://www.abcam.com/index.html?datasheet=4241 http://www.abcam.com/index.html...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up