Overview

  • Product nameAnti-INO80 antibody
    See all INO80 primary antibodies
  • Description
    Mouse polyclonal to INO80
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Schizosaccharomyces pombe
  • Immunogen

    Fusion protein:

    MDPSRETFDGSTRDSYKPPNGAEMMGQSELNTQNRIPYNTSANNRNWQIP LYWQQRGNEFQASPPPPLGYVTPEYGATGTPVNANNASRVDYATTAANVP

    , corresponding to amino acids 1/100 of Schizosaccharomyces pombe INO80

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab22238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 192 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • FunctionDNA helicase and probable main scaffold component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair; according to PubMed:20687897 the contribution to DNA double-strand break repair appears to be largely indirect through transcriptional regulation. Recruited by YY1 to YY1-activated genes, where it acts as an essential coactivator. Binds DNA. In vitro, has double stranded DNA-dependent ATPase activity. Involved in UV-damage excision repair, DNA replication and chromosome segregation during normal cell division cycle.
  • Tissue specificityAccording to PubMed:10574462, widely expressed. According to PubMed:16298340, specifically expressed in brain, liver and pancreas.
  • Sequence similaritiesBelongs to the SNF2/RAD54 helicase family.
    Contains 1 DBINO domain.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • DomainThe DBINO region is involved in binding to DNA.
  • Cellular localizationNucleus. Colocalizes with PCNA at replication forks during S-phase. Recruited to DNA damage sites in a ACTR8-dependent manner.
  • Information by UniProt
  • Alternative names
    • DNA helicase INO80 antibody
    • hINO80 antibody
    • homolog of yeast INO80 antibody
    • INO80 antibody
    • INO80 complex subunit A antibody
    • INO80 homolog antibody
    • INO80_HUMAN antibody
    • INO80A antibody
    • INOC1 antibody
    • KIAA1259 antibody
    • Putative DNA helicase INO80 complex homolog 1 antibody
    see all

References for Anti-INO80 antibody (ab22238)

ab22238 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. The immunogen sequence of anti INO80 does not show homology with human INO80 protein so it is more likely that this antibody will not work with human lysates. We unfortunately do not have any other anti INO80...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"