Anti-Integrin alpha 3a antibody [29A3] (ab8985)


  • Product name
    Anti-Integrin alpha 3a antibody [29A3]
  • Description
    Mouse monoclonal [29A3] to Integrin alpha 3a
  • Specificity
    Recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal cell layer in skin, glomeruli, Bowman’s capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.
  • Tested applications
    Suitable for: IHC-Fr, ICC, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide: C-RTRALYEAKRQKAEMKSQPSETERLTDDY conjugated to KLH.

  • Epitope
    Cytoplasmic domain of a3A Integrin. Phospho-epitope.
  • General notes

    The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix.


  • Form
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium Azide
    Constituents: PBS
  • Concentration information loading...
  • Purity
    Protein G purified
  • Primary antibody notes
    The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix.
  • Clonality
  • Clone number
  • Myeloma
  • Isotype
  • Light chain type
  • Research areas


Our Abpromise guarantee covers the use of ab8985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use at an assay dependent concentration. Recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent.
ICC Use at an assay dependent concentration.
WB 1/100 - 1/1000.


  • Relevance
    Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins.
  • Cellular localization
    Cell Membrane
  • Database links
  • Alternative names
    • CD49C antibody
    • GAPB3 antibody
    • ITGA3 antibody
    • MSK18 antibody
    • VL3A antibody
    see all

Anti-Integrin alpha 3a antibody [29A3] images

  • Immunohistochemistry on frozen section of human kidney

References for Anti-Integrin alpha 3a antibody [29A3] (ab8985)

ab8985 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab8985.
Please use the links above to contact us or submit feedback about this product.


Sign up