Anti-Integrin alpha 3a antibody [29A3] (ab8985)
Key features and details
- Mouse monoclonal [29A3] to Integrin alpha 3a
- Suitable for: IHC-Fr
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Integrin alpha 3a antibody [29A3] -
Description
Mouse monoclonal [29A3] to Integrin alpha 3a -
Host species
Mouse -
Specificity
29A3 recognizes specifically the cytoplasmic domain of integrin subunit α3A which is present in the basal cell layer in skin, glomeruli, Bowman’s capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.
-
Tested applications
Suitable for: IHC-Frmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide corresponding to Integrin alpha 3a conjugated to keyhole limpet haemocyanin.
Database link: P26006 -
Epitope
Cytoplasmic domain of a3A Integrin. Phospho-epitope. -
General notes
Background
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.Source
29A3 is a Mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.Formulation: Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Protein G purified -
Primary antibody notes
The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix. -
Clonality
Monoclonal -
Clone number
29A3 -
Myeloma
Sp2/0 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab8985 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-Fr |
Use at an assay dependent concentration.
Recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent. |
Notes |
---|
IHC-Fr
Use at an assay dependent concentration. Recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent. |
Target
-
Relevance
Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. -
Cellular localization
Cell Membrane -
Database links
- Entrez Gene: 3675 Human
- SwissProt: P26006 Human
-
Alternative names
- CD49C antibody
- GAPB3 antibody
- ITGA3 antibody
see all
Datasheets and documents
-
Datasheet download
References (1)
ab8985 has been referenced in 1 publication.
- Ryan D et al. Targeting AXL and RAGE to prevent geminin overexpression-induced triple-negative breast cancer metastasis. Sci Rep 9:19150 (2019). PubMed: 31844158