Overview

  • Product name
    Anti-Integrin alpha 3b antibody [54B3]
  • Description
    Mouse monoclonal [54B3] to Integrin alpha 3b
  • Specificity
    Recognizes specifically the cytoplasmic domain of integrin subunit a3B which is present in microvascular structures in brain and heart.
  • Tested applications
    Suitable for: WB, IHC-Fr, ICCmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: a wide range of other species
  • Immunogen

    Synthetic peptide: C-TRYYQIMPKYHAVRIREEERYPPPGSTLPTKK conjugated to KLH.

  • Epitope
    Cytoplasmic domain of a3B Integrin.
  • General notes


    The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium Azide
    Constituents: PBS
  • Concentration information loading...
  • Purity
    Protein G purified
  • Primary antibody notes
    The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix.
  • Clonality
    Monoclonal
  • Clone number
    54B3
  • Myeloma
    Sp2/0
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab8988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000.
IHC-Fr 1/25 - 1/200.
ICC Use at an assay dependent concentration.

Target

  • Relevance
    Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins.
  • Cellular localization
    Cell Membrane
  • Database links
  • Alternative names
    • CD49C antibody
    • GAPB3 antibody
    • Integrin alpha-3 heavy chain antibody
    • Integrin alpha-3 light chain antibody
    • ITGA3 antibody
    • MSK18 antibody
    • VL3A antibody
    see all

References for Anti-Integrin alpha 3b antibody [54B3] (ab8988)

This product has been referenced in:
  • Zhang K  et al. CTR9/PAF1c regulates molecular lineage identity, histone H3K36 trimethylation and genomic imprinting during preimplantation development. Dev Biol 383:15-27 (2013). Read more (PubMed: 24036311) »
  • Ipenberg I  et al. Heat shock protein 90 (Hsp90) selectively regulates the stability of KDM4B/JMJD2B histone demethylase. J Biol Chem 288:14681-7 (2013). Read more (PubMed: 23589305) »

See all 3 Publications for this product

Product Wall

There are currently no Abreviews or Questions for ab8988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up