
  • Product name
    Anti-Integrin alpha 3b antibody [54B3]
  • Description
    Mouse monoclonal [54B3] to Integrin alpha 3b
  • Host species
  • Specificity
    Recognizes specifically the cytoplasmic domain of integrin subunit a3B which is present in microvascular structures in brain and heart.
  • Tested applications
    Suitable for: WB, IHC-Fr, ICCmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: a wide range of other species
  • Immunogen

    Synthetic peptide: C-TRYYQIMPKYHAVRIREEERYPPPGSTLPTKK conjugated to KLH.

  • Epitope
    Cytoplasmic domain of a3B Integrin.
  • General notes

    The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix.


  • Form
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium Azide
    Constituents: PBS
  • Concentration information loading...
  • Purity
    Protein G purified
  • Primary antibody notes
    The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix.
  • Clonality
  • Clone number
  • Myeloma
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab8988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000.
IHC-Fr 1/25 - 1/200.
ICC Use at an assay dependent concentration.


  • Relevance
    Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins.
  • Cellular localization
    Cell Membrane
  • Database links
  • Alternative names
    • CD49C antibody
    • GAPB3 antibody
    • Integrin alpha-3 heavy chain antibody
    • Integrin alpha-3 light chain antibody
    • ITGA3 antibody
    • MSK18 antibody
    • VL3A antibody
    see all


This product has been referenced in:
  • Khalkar P  et al. Selenite and methylseleninic acid epigenetically affects distinct gene sets in myeloid leukemia: A genome wide epigenetic analysis. Free Radic Biol Med 117:247-257 (2018). WB ; Human . Read more (PubMed: 29438720) »
  • Tobiasson M  et al. Comprehensive mapping of the effects of azacitidine on DNA methylation, repressive/permissive histone marks and gene expression in primary cells from patients with MDS and MDS-related disease. Oncotarget 8:28812-28825 (2017). Read more (PubMed: 28427179) »

See all 5 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab8988.
Please use the links above to contact us or submit feedback about this product.


Sign up