Overview

  • Product name
    Anti-Integrin alpha 3b antibody [54B3]
  • Description
    Mouse monoclonal [54B3] to Integrin alpha 3b
  • Specificity
    Recognizes specifically the cytoplasmic domain of integrin subunit a3B which is present in microvascular structures in brain and heart.
  • Tested applications
    Suitable for: WB, IHC-Fr, ICCmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: a wide range of other species
  • Immunogen

    Synthetic peptide: C-TRYYQIMPKYHAVRIREEERYPPPGSTLPTKK conjugated to KLH.

  • Epitope
    Cytoplasmic domain of a3B Integrin.
  • General notes


    The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium Azide
    Constituents: PBS
  • Concentration information loading...
  • Purity
    Protein G purified
  • Primary antibody notes
    The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix.
  • Clonality
    Monoclonal
  • Clone number
    54B3
  • Myeloma
    Sp2/0
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab8988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000.
IHC-Fr 1/25 - 1/200.
ICC Use at an assay dependent concentration.

Target

  • Relevance
    Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins.
  • Cellular localization
    Cell Membrane
  • Database links
  • Alternative names
    • CD49C antibody
    • GAPB3 antibody
    • Integrin alpha-3 heavy chain antibody
    • Integrin alpha-3 light chain antibody
    • ITGA3 antibody
    • MSK18 antibody
    • VL3A antibody
    see all

References

This product has been referenced in:
  • Zhang K  et al. CTR9/PAF1c regulates molecular lineage identity, histone H3K36 trimethylation and genomic imprinting during preimplantation development. Dev Biol 383:15-27 (2013). Read more (PubMed: 24036311) »
  • Ipenberg I  et al. Heat shock protein 90 (Hsp90) selectively regulates the stability of KDM4B/JMJD2B histone demethylase. J Biol Chem 288:14681-7 (2013). Read more (PubMed: 23589305) »

See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab8988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up