Anti-Integrin beta 8 antibody (ab172007)

Overview

  • Product name
    Anti-Integrin beta 8 antibody
    See all Integrin beta 8 primary antibodies
  • Description
    Mouse polyclonal to Integrin beta 8
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Integrin beta 8 aa 1-769.
    Sequence:

    MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASS NAASCARCLALGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIE YPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVHPLKKYPVDLY YLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYI SIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNI DTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHW YKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIY FNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAII KPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCH FDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDD FSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV CSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLS QAILDQCKTSCALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLK VLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPE EIKMDISKLNAHETFRCNF


    Database link: P26012

  • Positive control
    • ITGB8 transfected 293T lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 86 kDa.

Target

  • Function
    Integrin alpha-V/beta-8 is a receptor for fibronectin.
  • Tissue specificity
    Placenta, kidney, brain, ovary, uterus and in several transformed cells. Transiently expressed in 293 human embryonic kidney cells.
  • Sequence similarities
    Belongs to the integrin beta chain family.
    Contains 1 VWFA domain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Integrin beta-8 antibody
    • ITB8_HUMAN antibody
    • ITGB 8 antibody
    • ITGB8 antibody

Images

  • All lanes : Anti-Integrin beta 8 antibody (ab172007) at 1 µg/ml

    Lane 1 : ITGB8 transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 86 kDa

References

ab172007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (Glioma)
Gel Running Conditions
Reduced Denaturing (10% gel)
Loading amount
25 µg
Specification
Glioma
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted May 11 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up