Anti-Interferon alpha 2 antibody (HRP) (ab193064)

Overview

  • Product name
    Anti-Interferon alpha 2 antibody (HRP)
    See all Interferon alpha 2 primary antibodies
  • Description
    Rabbit polyclonal to Interferon alpha 2 (HRP)
  • Conjugation
    HRP
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Interferon alpha 2 aa 24-188. mature form
    Sequence:

    CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA ETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVI QGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRS FSLSTNLQESLRSKE


    Database link: P01563

Properties

Applications

Our Abpromise guarantee covers the use of ab193064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/800. Predicted molecular weight: 22 kDa.

Target

  • Function
    Produced by macrophages, IFN-alpha have antiviral activities.
  • Sequence similarities
    Belongs to the alpha/beta interferon family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Alpha 2a interferon antibody
    • IFN alpha 2 antibody
    • IFN alphaA antibody
    • IFN-alpha-2 antibody
    • IFNA antibody
    • Ifna2 antibody
    • IFNA2_HUMAN antibody
    • IFNA2B antibody
    • INFA2 antibody
    • Interferon alpha 2a antibody
    • Interferon alpha 2b antibody
    • Interferon alpha A antibody
    • Interferon alpha-2 antibody
    • Interferon alpha-A antibody
    • Interferon antibody
    • LeIF A antibody
    • LeIFA antibody
    • MGC125764 antibody
    • MGC125765 antibody
    see all

References

ab193064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up