Anti-Interferon gamma antibody (Biotin) (ab193795)

Overview

  • Product name
    Anti-Interferon gamma antibody (Biotin)
    See all Interferon gamma primary antibodies
  • Description
    Rabbit polyclonal to Interferon gamma (Biotin)
  • Conjugation
    Biotin
  • Specificity
    Cross-reactivity: (Western blot) Recombinant bovine Interferon gamma (+++) Recombinant canine Interferon gamma (+++) Recombinant chicken Interferon gamma (+) Recombinant equine Interferon gamma (+++) Recombinant human Interferon gamma (+) Recombinant rabbit Interferon gamma (+) Recombinant swine Interferon gamma (+)
  • Tested applications
    Suitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Rabbit, Horse, Chicken, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Recombinant full length protein corresponding to Cat Interferon gamma aa 24-167.
    Sequence:

    QAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWKEESDKTIIQSQIV SFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLIQIP VNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK


    Database link: P46402

Properties

Applications

Our Abpromise guarantee covers the use of ab193795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use a concentration of 0.1 - 1 µg/ml.
WB Use a concentration of 0.1 - 1 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Function
    Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
  • Tissue specificity
    Released primarily from activated T lymphocytes.
  • Involvement in disease
    In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
  • Sequence similarities
    Belongs to the type II (or gamma) interferon family.
  • Post-translational
    modifications
    Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • IFG antibody
    • IFI antibody
    • IFN gamma antibody
    • IFN, immune antibody
    • IFN-gamma antibody
    • IFNG antibody
    • IFNG_HUMAN antibody
    • Immune interferon antibody
    • Interferon gamma antibody
    see all

References

ab193795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up