Anti-INTS2 antibody - N-terminal (ab178334)

Overview

  • Product name
    Anti-INTS2 antibody - N-terminal
  • Description
    Rabbit polyclonal to INTS2 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within Human INTS2 aa 225-274 (N terminal). The exact sequence is proprietary. NP_065799
    Sequence:

    VCRGLIKNGERQDEESLGGRRRTDALRFLCKMNPSQALKVRGMVVEECHL


    Database link: Q9H0H0

  • Positive control
    • MCF7 Whole Cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab178334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 134 kDa.

Target

  • Relevance
    INTS2 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Baillat et al., 2005 [PubMed 16239144]). INTS2 is a component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes.
  • Cellular localization
    Nuclear membrane
  • Database links
  • Alternative names
    • INT2 antibody
    • Integrator complex subunit 2 antibody
    • KIAA1287 antibody

Images

  • Anti-INTS2 antibody - N-terminal (ab178334) at 1 µg/ml + MCF7 whole cell lysates at 10 µg

    Predicted band size: 134 kDa

References

ab178334 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178334.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up