Overview

  • Product nameAnti-IOC4 antibody
  • Description
    Mouse polyclonal to IOC4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Fusion protein:

    MSEAIFQPTDIVLAKVKGFSAWPAMIIPNE

    , corresponding to N terminal amino acids 1/30 of Saccharomyces cerevisiae IOC4

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab22020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 55 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • RelevanceIOC4 is a member of a complex (Isw1b) with Isw1p and Ioc2p that exhibits nucleosome stimulated ATPase activity and acts within coding regions to coordinate transcription elongation with termination and processing. IOC4 contains a PWWP motif.
  • Cellular localizationNuclear
  • Database links
    • Alternative names
      • Hypothetical 55.4 kDa protein in MCM1-NUP116 intergenic region antibody
      • Ioc4p antibody
      • YMR044W antibody

    Anti-IOC4 antibody images

    • All lanes : Anti-IOC4 antibody (ab22020) at 1/1000 dilution

      Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
      Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

      Secondary
      Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

      Predicted band size : 55 kDa

    References for Anti-IOC4 antibody (ab22020)

    ab22020 has not yet been referenced specifically in any publications.

    Product Wall

    Application Western blot
    Sample Saccharomyces cerevisiae Cell lysate - whole cell (yeast)
    Loading amount 250 µg
    Specification yeast
    Gel Running Conditions Reduced Denaturing (4-12% Bis-Tris)
    Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C
    Username

    Abcam user community

    Verified customer

    Submitted Apr 08 2009

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"