Overview

  • Product name
  • Description
    Rabbit polyclonal to IP3KC
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human IP3KC aa 268-367.
    Sequence:

    QIQQDTDGSWTQPSTDGSQTAPGTDCLLGEPEDGPLEEPEPGELLTHLYS HLKCSPLCPVPRLIITPETPEPEAQPVGPPSRVEGGSGGFSSASSFDESE


    Database link: Q96DU7

  • Positive control
    • Human testis tissue; RT4 and U-251 MG sp cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 75 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Can phosphorylate inositol 2,4,5-triphosphate to inositol 2,4,5,6-tetraphosphate.
  • Tissue specificity
    Highly expressed in pancreas, skeletal muscle, liver, placenta and weakly in kidney and brain.
  • Involvement in disease
    Defects in ITPKC are a cause of Kawasaki disease (KWD) [MIM:611775]; also known as mucocutaneous lymph node syndrome or infantile polyarteritis. Kawasaki disease is an acute, self-limited vasculitis of infants and children characterized by prolonged fever unresponsive to antibiotics, polymorphous skin rash, erythema of the oral mucosa, lips, and tongue, erythema of the palms and soles, bilateral conjunctival injection, and cervical lymphadenopathy. Coronary artery aneurysms develop in 15 to 25% of those left untreated, making Kawasaki disease the leading cause of acquired heart disease among children in developed countries.
  • Sequence similarities
    Belongs to the inositol phosphokinase (IPK) family.
  • Cellular localization
    Nucleus. Cytoplasm. Shuttles actively between nucleus and cytoplasm with both nuclear import and nuclear export activity.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4 antibody
    • 5-trisphosphate 3-kinase C antibody
    • Inositol 1 antibody
    • inositol 1,4,5 trisphosphate 3 kinase C antibody
    • Inositol trisphosphate 3 kinase C antibody
    • Inositol-trisphosphate 3-kinase C antibody
    • InsP 3 kinase C antibody
    • InsP 3-kinase C antibody
    • IP3 3-kinase C antibody
    • IP3 3KC antibody
    • IP3K C antibody
    • IP3KC antibody
    • IP3KC_HUMAN antibody
    • Itpkc antibody
    see all

Images

  • All lanes : Anti-IP3KC antibody (ab188007) at 1/500 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U-251MG sp cell lysate


    Predicted band size : 75 kDa
  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling IP3KC with ab188007 at 1/1000 dilution.

References

ab188007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up