Anti-IRAK1BP1 antibody - C-terminal (ab177813)

Overview

  • Product name
    Anti-IRAK1BP1 antibody - C-terminal
    See all IRAK1BP1 primary antibodies
  • Description
    Rabbit polyclonal to IRAK1BP1 - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Human
  • Immunogen

    Synthetic peptide within Mouse IRAK1BP1 aa 210-259 (C terminal). The exact sequence is proprietary. (NP_075362)
    Sequence:

    WEGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL


    Database link: Q9ESJ7

  • Positive control
    • Mouse testis lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab177813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa.

Target

  • Relevance
    IRAK1BP1 is a component of the IRAK1 dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. It acts by enhancing RELA transcriptional activity.
  • Cellular localization
    Cytoplasmic and Nuclear
  • Database links
  • Alternative names
    • ActA binding protein 3 antibody
    • AIP70 antibody
    • Interleukin 1 receptor associated kinase 1 binding protein 1 antibody
    • IRAK1-binding protein 1 antibody
    • Signaling molecule that associates with Pelle-like kinase antibody
    • SIMPL antibody
    see all

Images

  • Anti-IRAK1BP1 antibody - C-terminal (ab177813) at 1 µg/ml + mouse testis lysate at 10 µg

    Predicted band size : 29 kDa

References

ab177813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up