Overview

  • Product name
  • Description
    Rabbit polyclonal to ISYNA1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to Human ISYNA1 aa 161-210.
    Sequence:

    LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD

  • Positive control
    • Fetal lung cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab74721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 61 kDa (predicted molecular weight: 61 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Key enzyme in myo-inositol biosynthesis pathway that catalyzes the conversion of glucose 6-phosphate to 1-myo-inositol 1-phosphate in a NAD-dependent manner. Rate-limiting enzyme in the synthesis of all inositol-containing compounds.
  • Tissue specificity
    Highly expressed in testis, ovary, heart, placenta and pancreas. Weakly expressed in blood leukocyte, thymus, skeletal muscle and colon.
  • Pathway
    Polyol metabolism; myo-inositol biosynthesis; myo-inositol from D-glucose 6-phosphate: step 1/2.
  • Sequence similarities
    Belongs to the myo-inositol-1-phosphate synthase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • hINO1 antibody
    • hIPS antibody
    • INO1 antibody
    • INO1_HUMAN antibody
    • INOS antibody
    • Inositol 3 phosphate synthase 1 antibody
    • Inositol-3-phosphate synthase 1 antibody
    • IPS antibody
    • IPS 1 antibody
    • ISYNA 1 antibody
    • Isyna1 antibody
    • MI 1 P synthase antibody
    • MI-1-P synthase antibody
    • MI1P synthase antibody
    • MIP synthase antibody
    • Myo inositol 1 phosphate synthase A1 antibody
    • Myo-inositol 1-phosphate synthase A1 antibody
    • Myo-inositol-1-phosphate synthase antibody
    see all

Images

  • Western blot analysis of Human adult placenta tissue lysate labeling ISYNA1 with ab74721 at 1.0µg/ml.
  • Western blot analysis of HepG2 cell lysate labeling ISYNA1 with ab74721 at 1.0µg/ml.
  • Anti-ISYNA1 antibody (ab74721) at 1 µg/ml + Fetal lung cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 61 kDa
    Observed band size: 61 kDa

References

ab74721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab74721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up