• Product nameAnti-ITPK1 antibody
    See all ITPK1 primary antibodies
  • Description
    Rabbit polyclonal to ITPK1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 35-84 (MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEY I) of Human ITPK1 (NP_055031).

  • Positive control
    • Human fetal heart lysate

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Our Abpromise guarantee covers the use of ab82739 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

  • FunctionKinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. Phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not. Also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway. Also acts as an inositol polyphosphate phosphatase that dephosphorylate Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 to Ins(1,3,4)P3, and Ins(1,3,4,5,6)P5 to Ins(3,4,5,6)P4. May also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. Probably acts as the rate-limiting enzyme of the InsP6 pathway. Modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain.
  • Tissue specificityExpressed in brain > heart > skeletal muscle = kidney = pancreas = liver = placenta > lung. In brain, it is expressed in cerebellum, cerebral cortex, medulla, spinal cord, occipital lobe, frontal lobe, temporal lobe and putamen.
  • Sequence similaritiesBelongs to the ITPK1 family.
    Contains 1 ATP-grasp domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 3 antibody
    • 4)P(3) 5/6-kinase antibody
    • 4-trisphosphate 5/6-kinase antibody
    • Inositol 1 3 4 triphosphate 5/6 kinase antibody
    • Inositol 1 3 4 trisphosphate 5/6 kinase antibody
    • Inositol 1 antibody
    • Inositol tetrakisphosphate 1 kinase antibody
    • Inositol triphosphate 5/6 kinase antibody
    • Inositol-tetrakisphosphate 1-kinase antibody
    • Inositol-triphosphate 5/6-kinase antibody
    • Ins(1 3 4)P(3) 5/6 kinase antibody
    • Ins(1 antibody
    • ITPK 1 antibody
    • itpk1 antibody
    • ITPK1_HUMAN antibody
    • ITRPK 1 antibody
    • ITRPK1 antibody
    see all

Anti-ITPK1 antibody images

References for Anti-ITPK1 antibody (ab82739)

ab82739 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82739.
Please use the links above to contact us or submit feedback about this product.