Overview

  • Product name
    Anti-IZUMO4 antibody
  • Description
    Rabbit polyclonal to IZUMO4
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human IZUMO4 aa 131-210. Isoform 2.
    Sequence:

    RCGIFQYETISCNNCTDSHVACFGYNCESSAQWKSAVQGLLNYINNWHKQ DTSMSLVSPALRCLEPPHLANLTLEDAAEC


    Database link: Q1ZYL8-2

  • Positive control
    • Human testis tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Allow to warm to room temp and agitate gently before aliquotting. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol

Target

  • Tissue specificity
    Detected in sperm.
  • Sequence similarities
    Belongs to the Izumo family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • C19orf36 antibody
    • IMAGE:4215339 antibody
    • IZUM4_HUMAN antibody
    • IZUMO family member 4 antibody
    • Izumo sperm-egg fusion protein 4 antibody
    • IZUMO4 antibody
    • putative SAMP14 binding protein variant 1 antibody
    • putative SAMP14 binding protein variant 2 antibody
    • Sperm 22 kDa protein c113 antibody
    • UNQ831/PRO1758 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue, labeling IZUMO4 with ab185119 at 1/20 dilution.

References

ab185119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up