Anti-JMJD5 antibody - ChIP Grade (ab83011)

Overview

  • Product nameAnti-JMJD5 antibody - ChIP Grade
    See all JMJD5 primary antibodies
  • Description
    Rabbit polyclonal to JMJD5 - ChIP Grade
  • Tested applicationsSuitable for: ChIP, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human JMJD5 aa 288-337 (internal sequence).
    Sequence:

    DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY


    Database link: Q8N371

  • Positive control
    • Fetal liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab83011 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ChIP Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-JMJD5 antibody - ChIP Grade images

  • ChIP analysis using ab83011 (0.5µg/mL) binding JMJD5 in human HCT116 colon cancer cells. Without (- peptide) and with (+ peptide) blocking peptide. Protein binding was detected using real-time PCR.

  • Anti-JMJD5 antibody - ChIP Grade (ab83011) at 1 µg/ml + fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 47 kDa
    Observed band size : 47 kDa

References for Anti-JMJD5 antibody - ChIP Grade (ab83011)

ab83011 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your email. I am sorry to hear that you have been experiencing problems with this antibody.

I have read the details you have kindly provided and have following further questions

- What is the problem with these products...

Read More

Thank you for contacting us.

Please find attached the codes;

XXXXXXX
XXXXXXX
XXXXXXX


We do not provide codes for linking antibodies to different molecules.

Please check the terms and conditions by click...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"