Overview

  • Product name
    Anti-JPH1 antibody
  • Description
    Rabbit polyclonal to JPH1
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Opossum, Elephant
  • Immunogen

    Synthetic peptide within Human JPH1 aa 450-500 (internal sequence). The exact sequence is proprietary.
    Sequence:

    KESPHFYRKGTTPPRSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKR S


    Database link: Q9HDC5

  • Positive control
    • HeLa and 293T cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab195312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 72 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release channels. JPH1 contributes to the construction of the skeletal muscle triad by linking the t-tubule (transverse-tubule) and SR (sarcoplasmic reticulum) membranes.
  • Tissue specificity
    Abundantly expressed in skeletal muscle. Very low levels in heart.
  • Sequence similarities
    Belongs to the junctophilin family.
    Contains 7 MORN repeats.
  • Domain
    The MORN (membrane occupation and recognition nexus) repeats contribute to the plasma membrane binding, possibly by interacting with phospholipids.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane. Sarcoplasmic reticulum membrane. Localized predominantly on the plasma membrane. The transmembrane domain is anchored in endoplasmic/sarcoplasmic reticulum membrane, while the N-terminal part associates with the plasma membrane. In skeletal muscle cells, it is predominantly localized at the junction of the A and I bands.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp762L0313 antibody
    • JP 1 antibody
    • JP-1 antibody
    • JP1 antibody
    • JPH 1 antibody
    • JPH1 antibody
    • JPH1_HUMAN antibody
    • Junctophilin 1 antibody
    • Junctophilin type 1 antibody
    • Junctophilin type1 antibody
    • Junctophilin-1 antibody
    • Junctophilin1 antibody
    • Mitsugumin 72 antibody
    • Mitsugumin72 antibody
    see all

Images

  • Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from 293T cells prepared using RIPA lysis buffer.  Antibodies: ab195312 used for IP at 6 µg per reaction. For blotting immunoprecipitated Junctophilin 1, ab195312 was used at 1 µg/mL.

  • All lanes : Anti-JPH1 antibody (ab195312) at 0.1 µg/ml

    Lane 1 : HeLa cell lysate
    Lane 2 : 293T cell lysate
    Lane 3 : Jurkat cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique

    Predicted band size : 72 kDa


    Exposure time : 3 minutes

References

ab195312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up