Anti-Junctional Adhesion Molecule C antibody (ab81331)

Overview

  • Product nameAnti-Junctional Adhesion Molecule C antibody
    See all Junctional Adhesion Molecule C primary antibodies
  • Description
    Rabbit polyclonal to Junctional Adhesion Molecule C
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to N terminal amino acids 72-122

    IGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYV

    of Human Junctional Adhesion Molecule C (EAW67820).

  • Positive control
    • HepG2 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab81331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500.

Target

  • FunctionParticipates in cell-cell adhesion. It is a counterreceptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN). The soluble form is a mediator of angiogenesis.
  • Tissue specificityHighest expression in placenta, brain and kidney. Significant expression is detected on platelets. Expressed in intestinal mucosa cells. Expressed in the vascular endothelium. Found in serum (at protein level). Also detected in the synovial fluid of patients with rheumatoid arthritis, psoriatic arthritis or ostearthritis (at protein level).
  • Involvement in diseaseDefects in JAM3 are the cause of hemorrhagic destruction of the brain with subependymal calcification and cataracts (HDBSCC) [MIM:613730]. A syndrome characterized by congenital cataracts and severe brain abnormalities apparently resulting from hemorrhagic destruction of the brain tissue, including the cerebral white matter and basal ganglia. Patients manifest profound developmental delay, and other neurologic features included seizures, spasticity, and hyperreflexia. Brain imaging shows multifocal intraparenchymal hemorrhage with associated liquefaction and massive cystic degeneration, and calcification in the subependymal region and in brain tissue.
  • Sequence similaritiesBelongs to the immunoglobulin superfamily.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    Proteolytically cleaved from endothelial cells surface into a soluble form by ADAM10 and ADAM17; the release of soluble JAM3 is increased by proinflammatory factors.
  • Cellular localizationCell membrane. Cell junction > desmosome. Secreted > extracellular space. In epithelial cells, it is expressed at desmosomes but not at tight junctions. Localizes at the cell surface of endothelial cells; treatment of endothelial cells with vascular endothelial growth factor stimulates recruitement of JAM3 to cell-cell contacts.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ14529 antibody
    • JAM 2 antibody
    • JAM 3 antibody
    • JAM C antibody
    • JAM-2 antibody
    • JAM-3 antibody
    • JAM-C antibody
    • JAM2 antibody
    • Jam3 antibody
    • JAM3_HUMAN antibody
    • JAMC antibody
    • Junctional adhesion molecule 3 antibody
    • Junctional adhesion molecule 3 precursor antibody
    • Junctional adhesion molecule C antibody
    see all

Anti-Junctional Adhesion Molecule C antibody images

  • Anti-Junctional Adhesion Molecule C antibody (ab81331) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 29 kDa
    Observed band size : 24 kDa (why is the actual band size different from the predicted?)
  • All lanes : Anti-Junctional Adhesion Molecule C antibody (ab81331) at 1/1000 dilution

    Lane 1 : JAM3-transfected HEK293 purified protein at 15 µg
    Lane 2 : JAM3-transfected HEK293 purified protein at 10 µg
    Lane 3 : JAM3-transfected HEK293 purified protein at 5 µg

    Secondary
    An HRP-conjugated goat anti-rabbit IgG at 1/5000 dilution
    Developed using the ECL technique

    Predicted band size : 29 kDa


    Exposure time : 10 seconds

    This image is courtesy of an anonymous Abreview

    See Abreview

References for Anti-Junctional Adhesion Molecule C antibody (ab81331)

ab81331 has not yet been referenced specifically in any publications.

Product Wall

Abcam has not validated the combination of species/application used in this Abreview.
Application Immunocytochemistry/ Immunofluorescence
Sample Human Cell (JAM3 transfected HEK 293)
Specification JAM3 transfected HEK 293
Fixative Paraformaldehyde
Permeabilization Yes - 0.075% Triton X-100
Blocking step Gelatin as blocking agent for 14 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 4°C
Username

Abcam user community

Verified customer

Submitted Mar 05 2010

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Western blot
Sample Human Purified protein (HEK 293)
Loading amount 10 µg
Specification HEK 293
Treatment JAM3-transfected
Gel Running Conditions Reduced Denaturing (NuPAGE10%Bis-Tris)
Blocking step Milk as blocking agent for 16 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C
Username

Abcam user community

Verified customer

Submitted Mar 05 2010

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"