Overview

  • Product nameAnti-Junctophilin-2 antibody
    See all Junctophilin-2 primary antibodies
  • Description
    Rabbit polyclonal to Junctophilin-2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 66-115 (

    QGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSTNSGAKYEGTWNNGLQ

    ) of Mouse Junctophilin-2 (NP_067541).

  • Positive control
    • Mouse pancreas lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab116077 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 75 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionContributes to the stabilization of the junctional membrane complexes, which are common to excitable cells and mediate cross-talk between cell surface and intracellular ion channels. Probably acts by anchoring the plasma membrane and endoplasmic/sarcoplasmic reticulum. Contributes to the construction of skeletal muscle triad junctions, and plays an essential role in heart development.
  • Tissue specificitySpecifically expressed in skeletal muscle and heart.
  • Involvement in diseaseDefects in JPH2 are the cause of cardiomyopathy familial hypertrophic type 17 (CMH17) [MIM:613873]. CMH17 is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
  • Sequence similaritiesBelongs to the junctophilin family.
    Contains 8 MORN repeats.
  • DomainThe MORN (membrane occupation and recognition nexus) repeats contribute to the plasma membrane binding, possibly by interacting with phospholipids.
  • Cellular localizationCell membrane. Endoplasmic reticulum membrane. Sarcoplasmic reticulum membrane. Localized predominantly on the plasma membrane. The transmembrane domain is anchored in endoplasmic/sarcoplasmic reticulum membrane, while the N-terminal part associates with the plasma membrane. In heart cells, it predominantly associates along Z lines within myocytes. In skeletal muscle, it is specifically localized at the junction of A and I bands.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ40969 antibody
    • JP-2 antibody
    • JP2 antibody
    • Jph2 antibody
    • JPH2_HUMAN antibody
    • Junctophilin 2 antibody
    • Junctophilin type 2 antibody
    • Junctophilin-2 antibody
    • OTTHUMP00000031651 antibody
    • OTTHUMP00000031652 antibody
    see all

Anti-Junctophilin-2 antibody images

  • Anti-Junctophilin-2 antibody (ab116077) at 1 mg/ml + Mouse pancreas lysate at 10 µg

    Predicted band size : 75 kDa

References for Anti-Junctophilin-2 antibody (ab116077)

ab116077 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116077.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"