Overview

  • Product nameAnti-KANK3 antibody
    See all KANK3 primary antibodies
  • Description
    Rabbit polyclonal to KANK3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 2 - 51 (

    AKFALNQNLPDLGGPRLCPVPAAGGARSPSSPYSVETPYGFHLDLDFLKY

    ) of Human KANK3 (NP_940873)

  • Positive control
    • Fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 88 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in the control of cytoskeleton formation by regulating actin polymerization.
  • Tissue specificityStrongly expressed in breast, liver, lung, skeletal muscle and kidney.
  • Sequence similaritiesContains 5 ANK repeats.
  • Information by UniProt
  • Database links
  • Alternative names
    • ANKRD47 antibody
    • Ankyrin repeat domain 47 antibody
    • Ankyrin repeat domain containing protein 47 antibody
    • Ankyrin repeat domain-containing protein 47 antibody
    • FLJ46061 antibody
    • KANK3 antibody
    • KANK3_HUMAN antibody
    • Kidney ankyrin repeat containing protein 3 antibody
    • KN motif and ankyrin repeat domain containing protein 3 antibody
    • KN motif and ankyrin repeat domain-containing protein 3 antibody
    • KN motif and ankyrin repeat domains 3 antibody
    • Ng28 antibody
    see all

Anti-KANK3 antibody images

  • Anti-KANK3 antibody (ab90014) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 88 kDa

References for Anti-KANK3 antibody (ab90014)

ab90014 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"