Anti-KAT13C / NCOA2 antibody (ab94502)

Overview

  • Product nameAnti-KAT13C / NCOA2 antibody
    See all KAT13C / NCOA2 primary antibodies
  • Description
    Rabbit polyclonal to KAT13C / NCOA2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 2-51 (

    SGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAE

    ) of Human KAT13C/ NCOA2 (NP_006531)

  • Positive control
    • Human fetal thymus lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 159 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionTranscriptional coactivator for steroid receptors and nuclear receptors. Coactivator of the steroid binding domain (AF-2) but not of the modulating N-terminal domain (AF-1). Required with NCOA1 to control energy balance between white and brown adipose tissues.
  • Involvement in diseaseNote=Chromosomal aberrations involving NCOA2 may be a cause of acute myeloid leukemias. Inversion inv(8)(p11;q13) generates the KAT6A-NCOA2 oncogene, which consists of the N-terminal part of KAT6A and the C-terminal part of NCOA2/TIF2. KAT6A-NCOA2 binds to CREBBP and disrupts its function in transcription activation.
  • Sequence similaritiesBelongs to the SRC/p160 nuclear receptor coactivator family.
    Contains 1 bHLH (basic helix-loop-helix) domain.
    Contains 1 PAS (PER-ARNT-SIM) domain.
  • DomainContains four Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs. The LXXLL motifs are essential for the association with nuclear receptors and are, at least in part, functionally redundant.
    The LLXXLXXXL motif is involved in transcriptional coactivation and CREBBP/CBP binding.
    Contains 2 C-terminal transcription activation domains (AD1 and AD2) that can function independently.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • bHLHe75 antibody
    • Class E basic helix-loop-helix protein 75 antibody
    • glucocorticoid receptor interacting protein 1 antibody
    • GRIP 1 antibody
    • GRIP1 antibody
    • hTIF2 antibody
    • MED1 antibody
    • MGC138808 antibody
    • NCoA 2 antibody
    • NCoA-2 antibody
    • Ncoa2 antibody
    • NCOA2_HUMAN antibody
    • Nuclear receptor coactivator 2 antibody
    • Oncogene FGR antibody
    • p160 antibody
    • SRC 2 antibody
    • src2 antibody
    • Steroid receptor coactivator 2 antibody
    • TIF 2 antibody
    • TIF2 antibody
    • Transcriptional intermediary factor 2 antibody
    see all

Anti-KAT13C / NCOA2 antibody images

  • Anti-KAT13C / NCOA2 antibody (ab94502) at 1 µg/ml + Fetal thymus lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 159 kDa

References for Anti-KAT13C / NCOA2 antibody (ab94502)

ab94502 has not yet been referenced specifically in any publications.

Product Wall

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Western blot
Sample Human Cell lysate - whole cell (HeLa)
Loading amount 150 µg
Specification HeLa
Gel Running Conditions Reduced Denaturing (8%)
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Mr. Christian Marx

Verified customer

Submitted Oct 25 2012

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"