Anti-KAT4 / TBP Associated Factor 1 antibody (ab24427)

Overview

  • Product nameAnti-KAT4 / TBP Associated Factor 1 antibodySee all KAT4 / TBP Associated Factor 1 primary antibodies ...
  • Description
    Mouse polyclonal to KAT4 / TBP Associated Factor 1
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Fusion protein: LSNDDKYQILKKTHQTKVRSTISNLNIQHSQPAINLQSPFYKVAVPRYQL RHFHRENFGSHIRPGTKIVFSKLKARKRKRDKGKDVKESFSTSQDLTIGD , corresponding to amino acids 441/540 of Saccharomyces cerevisiae TAF1

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab24427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB
  • Application notesWB: 1/1000. Predicted molecular weight: 120 kDa.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.
  • Target

    • FunctionLargest component and core scaffold of the TFIID basal transcription factor complex. Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors. Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53. Phosphorylates GTF2A1 and GTF2F1 on Ser residues. Possesses DNA-binding activity. Essential for progression of the G1 phase of the cell cycle.
    • Involvement in diseaseDefects in TAF1 are the cause of dystonia type 3 (DYT3) [MIM:314250]; also called X-linked dystonia-parkinsonism (XDP). DYT3 is a X-linked dystonia-parkinsonism disorder. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT3 is characterized by severe progressive torsion dystonia followed by parkinsonism. Its prevalence is high in the Philippines. DYT3 has a well-defined pathology of extensive neuronal loss and mosaic gliosis in the striatum (caudate nucleus and putamen) which appears to resemble that in Huntington disease.
    • Sequence similaritiesBelongs to the TAF1 family.
      Contains 2 bromo domains.
      Contains 1 HMG box DNA-binding domain.
      Contains 2 protein kinase domains.
    • Post-translational
      modifications
      Phosphorylated by casein kinase II in vitro.
    • Cellular localizationNucleus.
    • Target information above from: UniProt accession P21675 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links
      • Alternative names
        • BA2R antibody
        • CCG 1 antibody
        • CCG1 antibody
        • CCGS antibody
        • Cell cycle G1 phase defect antibody
        • Cell cycle gene 1 protein antibody
        • Complementation of cell cycle block G1 to S antibody
        • DYT3 antibody
        • DYT3 protein antibody
        • N TAF1 antibody
        • NSCL 2 antibody
        • NSCL2 antibody
        • OF antibody
        • p250 antibody
        • TAF 1 antibody
        • TAF 2A antibody
        • TAF(II)250 antibody
        • TAF1 antibody
        • TAF1 RNA polymerase II TATA box binding protein (TBP) associated factor 250kDa antibody
        • TAF1 RNA polymerase II TATA box binding protein (TBP) associated factor antibody
        • TAF1 RNA polymerase II TATA box binding protein associated factor 250kDa antibody
        • TAF1_HUMAN antibody
        • TAF2A antibody
        • TAFII 250 antibody
        • TAFII-250 antibody
        • TAFII250 antibody
        • TATA box binding protein (TBP) associated factor RNA polymerase II A antibody
        • TATA box binding protein (TBP) associated factor RNA polymerase II A 250kD antibody
        • TBP associated factor 250 kDa antibody
        • TBP-associated factor 250 kDa antibody
        • Transcription factor TFIID p250 polypeptide antibody
        • Transcription initiation factor TFIID 250 kDa subunit antibody
        • Transcription initiation factor TFIID subunit 1 antibody
        • XDP antibody
        see all

      Anti-KAT4 / TBP Associated Factor 1 antibody images

      • All lanes : Anti-KAT4 / TBP Associated Factor 1 antibody (ab24427) at 1/1000 dilution

        Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
        Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

        Secondary
        Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

        Predicted band size : 120 kDa

      References for Anti-KAT4 / TBP Associated Factor 1 antibody (ab24427)

      ab24427 has not yet been referenced specifically in any publications.

      Product Wall

      Application ChIP
      Sample Saccharomyces cerevisiae Cell lysate - whole cell (no case)
      Specification no case
      Type Cross-linking (X-ChIP)
      Duration of cross-linking step: 60 minute(s) and 0 second(s)
      Specification of the cross-linking agent: 1% formaldehyde final concentr
      Detection step Real-time PCR
      Positive control The given gene in Active conditions and a very strong constitutive gene TEF1.
      Negative control The given gene at INACTIVE conditions and a 3" UTR of the same gene at ACTIVE conditions
      Username

      Abcam user community

      Verified customer

      Submitted Nov 22 2007

      Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"