Overview

  • Product name
    Anti-KATNAL2 antibody
  • Description
    Rabbit polyclonal to KATNAL2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human KATNAL2 aa 178-261.
    Sequence:

    NAHPRRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFI GMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDA


    Database link: Q8IYT4

  • Positive control
    • Human stomach tissue, RT-4 and U-251MG cell lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab184829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 61 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays.
  • Sequence similarities
    Belongs to the AAA ATPase family. Katanin p60 subunit A1 subfamily. A-like 2 sub-subfamily.
    Contains 1 LisH domain.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZP667C165 antibody
    • Katanin p60 ATPase-containing subunit A-like 2 antibody
    • Katanin p60 subunit A like 2 antibody
    • Katanin p60 subunit A-like 2 antibody
    • KATL2_HUMAN antibody
    • KATNAL 2 antibody
    • katnal2 antibody
    • MGC33211 antibody
    • p60 katanin like 2 antibody
    • p60 katanin-like 2 antibody
    see all

Images

  • All lanes : Anti-KATNAL2 antibody (ab184829) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251MG cell lysate

    Secondary
    All lanes : HRP-conjugated Swine Anti-Rabbit IgG

    Predicted band size: 61 kDa

  • Immunohistochemical analysis of paraffin-embedded human stomach labeling KATNAL2 with ab184829 at 1/50 dilution showing strong cytoplasmic positivity in glandular cells. 

References

ab184829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up