Anti-KBTBD5 antibody (ab21779)

Overview

• Product nameAnti-KBTBD5 antibody
  See all KBTBD5 primary antibodies
• Description
  Mouse polyclonal to KBTBD5
• Tested applicationsSuitable for: WBmore details
• Species reactivity
  Reacts with: Mouse
  
• Immunogen

  Fusion protein:

  TLRKKKKEKGEQTARAKEANQGTEDTKAEDDEERVLPGILNDTLRFGMFL QDLIFMISEEGAVAYDPAANECYCASLSTQIPKNHVSLVTKENQVFVAGG

  , corresponding to amino acids 267-366 of Mouse KRP1.
  Run BLAST with Run BLAST with
• General notesProduced from outbred CD1 mice

  
  

  This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

• FormLiquid
• Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
• Storage bufferConstituents: 50% Glycerol
• PurityWhole antiserum
• Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
• ClonalityPolyclonal
• IsotypeIgG
• Research areas
  • Epigenetics and Nuclear Signaling
  • DNA / RNA
  • DNA Damage & Repair
  • DNA Damage Response
  • Other

Associated products

• Compatible Secondaries
  • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
  • Goat Anti-Mouse IgG H&L (HRP) (ab205719)

Applications

Target

• Sequence similaritiesContains 1 BACK (BTB/Kelch associated) domain.
  Contains 1 BTB (POZ) domain.
  Contains 5 Kelch repeats.

• Target information above from: UniProt accession Q2TBA0 The UniProt Consortium
  The Universal Protein Resource (UniProt) in 2010
  Nucleic Acids Res. 38:D142-D148 (2010) .

  Information by UniProt
• Database links
  • Entrez Gene: 72330 Mouse
  • SwissProt: Q9D783 Mouse
  • Unigene: 45734 Mouse
• Alternative names
  • KBTB5_HUMAN antibody
  • kbtbd5 antibody
  • Kelch repeat and BTB (POZ) domain containing 5 antibody

  • Kelch repeat and BTB domain-containing protein 5 antibody
  • Sarcosynapsin antibody
  • SRYP antibody

  see all