Anti-KBTBD5 antibody (ab21779)

Overview

• Product name
  Anti-KBTBD5 antibody
  See all KBTBD5 primary antibodies
• Description
  Mouse polyclonal to KBTBD5
• Tested applications
  Suitable for: WBmore details
• Species reactivity
  Reacts with: Mouse
  
• Immunogen

  Fusion protein:

  TLRKKKKEKGEQTARAKEANQGTEDTKAEDDEERVLPGILNDTLRFGMFL QDLIFMISEEGAVAYDPAANECYCASLSTQIPKNHVSLVTKENQVFVAGG

  , corresponding to amino acids 267-366 of Mouse KRP1.

  Run BLAST with Run BLAST with
• General notes
  Produced from outbred CD1 mice

  
  

  This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

• Form
  Liquid
• Storage instructions
  Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
• Storage buffer
  Constituents: 50% Glycerol
• Purity
  Whole antiserum
• Primary antibody notes
  This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
• Clonality
  Polyclonal
• Isotype
  IgG
• Research areas
  • Epigenetics and Nuclear Signaling
  • DNA / RNA
  • DNA Damage & Repair
  • DNA Damage Response
  • Other

Associated products

• Compatible Secondaries
  • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
  • Goat Anti-Mouse IgG H&L (HRP) (ab205719)

Applications

Target

• Sequence similarities
  Contains 1 BACK (BTB/Kelch associated) domain.
  Contains 1 BTB (POZ) domain.
  Contains 5 Kelch repeats.

• Target information above from: UniProt accession Q2TBA0 The UniProt Consortium
  The Universal Protein Resource (UniProt) in 2010
  Nucleic Acids Res. 38:D142-D148 (2010) .

  Information by UniProt
• Database links
  • Entrez Gene: 72330 Mouse
  • SwissProt: Q9D783 Mouse
  • Unigene: 45734 Mouse
• Alternative names
  • KBTB5_HUMAN antibody
  • kbtbd5 antibody
  • Kelch repeat and BTB (POZ) domain containing 5 antibody

  • Kelch repeat and BTB domain-containing protein 5 antibody
  • Sarcosynapsin antibody
  • SRYP antibody

  see all

Protocols

• Western blot protocols