Overview

  • Product name
  • Description
    Rabbit polyclonal to KCNE1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human KCNE1 aa 1-105.
    Sequence:

    MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMV LGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVL ESYRS


    Database link: P15282

  • Positive control
    • Mouse heart cell lysate; Mouse testis cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab180843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000.

Target

  • Function
    Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr).
  • Tissue specificity
    Expressed in heart, lung, kidney, testis, ovaries, small intestine, peripheral blood leukocytes. Not detected in pancreas, spleen, prostate and colon. Restrictively localized in the apical membrane portion of epithelial cells.
  • Involvement in disease
    Jervell and Lange-Nielsen syndrome 2 (JLNS2) [MIM:612347]: An autosomal recessive disorder characterized by congenital deafness, prolongation of the QT interval, syncopal attacks due to ventricular arrhythmias, and a high risk of sudden death. Note=The disease is caused by mutations affecting the gene represented in this entry.
    Long QT syndrome 5 (LQT5) [MIM:613695]: A heart disorder characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to exercise or emotional stress, and can present with a sentinel event of sudden cardiac death in infancy. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities
    Belongs to the potassium channel KCNE family.
  • Post-translational
    modifications
    Phosphorylation inhibits the potassium current.
    N-glycosylation at Asn-26 occurs post-translationally, and requires prior cotranslational glycosylation at Asn-5.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Delayed rectifier potassium channel subunit IsK antibody
    • Human cardiac delayed rectifier potassium channel protein antibody
    • IKs producing slow voltage gated potassium channel subunit beta Mink antibody
    • IKs producing slow voltage-gated potassium channel subunit beta Mink antibody
    • ISK antibody
    • JLNS 2 antibody
    • JLNS antibody
    • JLNS2 antibody
    • KCNE 1 antibody
    • KCNE1 antibody
    • KCNE1_HUMAN antibody
    • LQT 5 antibody
    • LQT5 antibody
    • MGC33114 antibody
    • Minimal potassium channel antibody
    • MinK antibody
    • Potassium voltage gated channel Isk related family member 1 antibody
    • Potassium voltage gated channel Isk related subfamily member 1 antibody
    • Potassium voltage gated channel subfamily E member 1 antibody
    • Potassium voltage-gated channel subfamily E member 1 antibody
    see all

Images

  • All lanes : Anti-KCNE1 antibody (ab180843) at 1/500 dilution

    Lane 1 : Mouse heart cell lysate
    Lane 2 : Mouse testis cell lysate

References

ab180843 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180843.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up