Overview

  • Product nameAnti-KCNK9 antibody
  • Description
    Rabbit polyclonal to KCNK9
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 36-85 (

    REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY

    ) of human KCNK9 (NP_057685)

  • Positive control
    • HepG2 Cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab85289 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceKCNK9 or TASK-3 (TWIK-related Acid sensitive K+ channel) is a member of the potassium channel family of proteins that contain two-pore domain and four transmembrane domains. These channels are characterized as leak K+ channels that are sensitive to changes in the extracellular pH. The physiological functions of TASK channels are largely unknown; it has been proposed that they may be involved in the regulation of breathing, aldosterone secretion and anesthetic-mediated neuronal activity. They were found to act in neurons' membrane potential and in resting K+ currents. KCNK9 gene has been localized to the chromosomal region 8q24. The protein is expressed at high levels mainly in the brain and at low levels in other tissues. In contrast to normal tissues, it was found that KCNK9 is amplified in some human carcinomas such as breast, lung, colon and metastatic prostate. In 10% of breast cancer patients this gene is amplified, and in 44% the protein is over expressed. Monoclonal antibodies to KNCK9 are an important tool for studying the potassium channel family of proteins in different tissues.
  • Cellular localizationPlasma membrane
  • Database links
  • Alternative names
    • Acid sensitive potassium channel protein TASK 3 antibody
    • K2p9.1 antibody
    • KT3.2 antibody
    • MGC138268 antibody
    • MGC138270 antibody
    • Potassium channel TASK3 antibody
    • Potassium channel, subfamily K, member 9 (TASK 3) antibody
    • Potassium channel, subfamily K, member 9 antibody
    • TASK 3 antibody
    • TWIK related acid sensitive K+ channel 3 antibody
    see all

Anti-KCNK9 antibody images



  • Predicted band size : 42 kDa
    Western blot analysis of Human fetal brain tissue lysate labeling KCNK9 with ab85289 at 1.0µg/ml.
  • Anti-KCNK9 antibody (ab85289) at 1 µg/ml + HepG2 Cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1: 50,000

    Predicted band size : 42 kDa
    Observed band size : 40 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 50 kDa. We are unsure as to the identity of these extra bands.
    Gel concentration: 12%
  • ab85289 staining KCNK9 in human prostate tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human prostate tissue labelling KCNNK9 with ab85289 at 5.0ug/ml.

References for Anti-KCNK9 antibody (ab85289)

ab85289 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85289.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"