Overview

  • Product name
  • Description
    Rabbit polyclonal to KCNV1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAV P) of human KCNV1 (NP_055194).

  • Positive control
    • 293T cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    Purified by peptide affinity chromatography method.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab85495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 56 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Potassium channel subunit that does not form functional channels by itself. Modulates KCNB1 and KCNB2 channel activity by shifting the threshold for inactivation to more negative values and by slowing the rate of inactivation. Can down-regulate the channel activity of KCNB1, KCNB2, KCNC4 and KCND1, possibly by trapping them in intracellular membranes.
  • Tissue specificity
    Detected in brain.
  • Sequence similarities
    Belongs to the potassium channel family. V (TC 1.A.1.2) subfamily. Kv8.1/KCNV1 sub-subfamily.
  • Domain
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization
    Cell membrane. Has to be associated with another potassium channel subunit to get inserted in the plasma membrane. Remains intracellular in the absence of KCNB2.
  • Information by UniProt
  • Database links
  • Alternative names
    • KCNV1 antibody
    • KCNV1_HUMAN antibody
    • Neuronal potassium channel alpha subunit HNKA antibody
    • Potassium voltage gated channel subfamily V member 1 antibody
    • Potassium voltage-gated channel subfamily V member 1 antibody
    • Voltage gated potassium channel subunit Kv8.1 antibody
    • Voltage-gated potassium channel subunit Kv8.1 antibody
    see all

Anti-KCNV1 antibody images

  • Anti-KCNV1 antibody (ab85495) at 1 µg/ml ( in 5% skim milk / PBS buffer) + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 56 kDa
    Observed band size : 56 kDa

References for Anti-KCNV1 antibody (ab85495)

ab85495 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up