Overview

  • Product nameAnti-KCTD21 antibody
    See all KCTD21 primary antibodies
  • Description
    Rabbit polyclonal to KCTD21
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 37-86 PTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFY of Human KCTD21, NP_001025030

  • Positive control
    • Fetal brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab81494 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500.

Target

Anti-KCTD21 antibody images

  • Anti-KCTD21 antibody (ab81494) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 29 kDa
    Observed band size : 33 kDa (why is the actual band size different from the predicted?)

References for Anti-KCTD21 antibody (ab81494)

ab81494 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81494.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"