Anti-KDM3B / JMJD1B antibody (ab66654)

Overview

  • Product nameAnti-KDM3B / JMJD1B antibody
    See all KDM3B / JMJD1B primary antibodies
  • Description
    Rabbit polyclonal to KDM3B / JMJD1B
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human KDM3B/ JMJD1B (C terminal).
    Sequence:

    VHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNII


    Database link: Q7LBC6

  • Positive control
    • Fetal thymus lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab66654 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Predicted molecular weight: 192 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionHistone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May have tumor suppressor activity.
  • Tissue specificityUbiquitous. Highly expressed in placenta, skeletal muscle, kidney, heart and liver.
  • Sequence similaritiesBelongs to the JHDM2 histone demethylase family.
    Contains 1 JmjC domain.
  • DomainLeu-Xaa-Xaa-Leu-Leu (LXXLL) motifs are known to mediate the association with nuclear receptors.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 5qNCA antibody
    • C5orf7 antibody
    • JHDM2B antibody
    • JmjC domain containing histone demethylation protein 2B antibody
    • JmjC domain-containing histone demethylation protein 2B antibody
    • jmjd1b antibody
    • Jumonji domain containing 1B antibody
    • Jumonji domain containing protein 1B antibody
    • Jumonji domain-containing protein 1B antibody
    • KDM3B antibody
    • KDM3B_HUMAN antibody
    • KIAA1082 antibody
    • Lysine (K) specific demethylase 3B antibody
    • Lysine-specific demethylase 3B antibody
    • NET22 antibody
    • Nuclear protein 5qNCA antibody
    see all

Anti-KDM3B / JMJD1B antibody images

  • Anti-KDM3B / JMJD1B antibody (ab66654) at 2.5 µg/ml + Fetal thymus lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 192 kDa
    Observed band size : 192 kDa

References for Anti-KDM3B / JMJD1B antibody (ab66654)

ab66654 has not yet been referenced specifically in any publications.

Product Wall

DISCOUNT CODE: ************* Expiration date: *********** I am very pleased to hear you would like to accept our offer and test ab66654 in rat tissue. This code will give you 1 free PRIMARY ANTIBODYbefore the expiration date. To redeem this offer, plea...

Read More

DISCOUNT CODE: *************** Expiration date: ************ I am very pleased to hear you would like to accept our offer and test ab66654 in rat and mouse tissue. This code will give you 1 free PRIMARY ANTIBODY before the expiration date. To redeem th...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"