Anti-KDM4A / JHDM3A / JMJD2A antibody (ab176199)

Overview

  • Product name
    Anti-KDM4A / JHDM3A / JMJD2A antibody
    See all KDM4A / JHDM3A / JMJD2A primary antibodies
  • Description
    Rabbit polyclonal to KDM4A / JHDM3A / JMJD2A
  • Tested applications
    Suitable for: WBmore details
    Unsuitable for: Flow Cyt or IHC-P
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human KDM4A/ JHDM3A/ JMJD2A aa 1-350.
    Sequence:

    MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPP KEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKI ANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNI GRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYL HFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLML KKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYG KQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEA


    Database link: O75164

  • Positive control
    • DLD1 cell lysate, lung tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab176199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200. Predicted molecular weight: 121 kDa.
  • Application notes
    Is unsuitable for Flow Cyt or IHC-P.
  • Target

    • Function
      Histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-20'. Demethylates trimethylated H3 'Lys-9' and H3 'Lys-36' residue, while it has no activity on mono- and dimethylated residues. Demethylation of Lys residue generates formaldehyde and succinate. Participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively.
      Isoform 2: Crucial for muscle differentiation, promotes transcriptional activation of the Myog gene by directing the removal of repressive chromatin marks at its promoter. Lacks the N-terminal demethylase domain.
    • Tissue specificity
      Ubiquitous.
    • Sequence similarities
      Belongs to the JHDM3 histone demethylase family.
      Contains 1 C2HC pre-PHD-type zinc finger.
      Contains 1 JmjC domain.
      Contains 1 JmjN domain.
      Contains 2 PHD-type zinc fingers.
      Contains 2 Tudor domains.
    • Domain
      The 2 Tudor domains recognize and bind methylated histone H3 'Lys-4' residue (H3K4me). Double Tudor domain has an interdigitated structure and the unusual fold is required for its ability to bind methylated histone tails. Trimethylated H3 'Lys-4' (H3K4me3) is bound in a cage of 3 aromatic residues, 2 of which are from the Tudor domain 2, while the binding specificity is determined by side-chain interactions involving residues from the Tudor domain 1. The Tudor domains are also able to bind trimethylated histone H3 'Lys-9' (H3K9me3), di- and trimethylated H4 'Lys-20' (H4K20me2 and H4K20me3). Has high affinity for H4K20me2, blocking recruitment of proteins such as TP53BP1.
    • Post-translational
      modifications
      Ubiquitinated by RNF8 and RNF168 following DNA damage, leading to its degradation. Degradation promotes accessibility of H4K20me2 mark for DNA repair protein TP53BP1, which is then recruited.
    • Cellular localization
      Nucleus.
    • Information by UniProt
    • Database links
    • Alternative names
      • JHDM3A antibody
      • JmjC domain containing histone demethylation protein 3A antibody
      • JmjC domain-containing histone demethylation protein 3A antibody
      • JMJD2 antibody
      • JMJD2A antibody
      • jumonji C domain containing histone demethylase 3A antibody
      • Jumonji domain containing 2 antibody
      • Jumonji domain containing 2A antibody
      • Jumonji domain containing protein 2A antibody
      • Jumonji domain-containing protein 2A antibody
      • KDM4A antibody
      • KDM4A_HUMAN antibody
      • KIAA0677 antibody
      • Lysine (K) specific demethylase 4A antibody
      • Lysine-specific demethylase 4A antibody
      • TDRD14A antibody
      • Tudor domain containing 14A antibody
      see all

    Images

    • All lanes : Anti-KDM4A / JHDM3A / JMJD2A antibody (ab176199) at 1/200 dilution

      Lane 1 : DLD1 cell lysate at 30 µg
      Lane 2 : DLD1 cell lysate at 60 µg


      Predicted band size : 121 kDa

    References

    ab176199 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab176199.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up