Anti-KDM6A / UTX antibody (ab84190)

Overview

  • Product nameAnti-KDM6A / UTX antibody
    See all KDM6A / UTX primary antibodies
  • Description
    Rabbit polyclonal to KDM6A / UTX
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human KDM6A/ UTX aa 1352-1401 (C terminal).
    Sequence:

    KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS


    Database link: O15550

  • Positive control
    • MCF7 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab84190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 154 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionHistone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. Plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitent with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A.
  • Sequence similaritiesBelongs to the UTX family.
    Contains 1 JmjC domain.
    Contains 8 TPR repeats.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX) antibody
    • bA386N14.2 antibody
    • bA386N14.2 ubiquitously transcribed X chromosome tetratricopeptide repeat protein UTX antibody
    • DKFZp686A03225 antibody
    • Histone demethylase UTX antibody
    • KABUK2 antibody
    • Kdm6a antibody
    • KDM6A_HUMAN antibody
    • Lysine (K) specific demethylase 6A antibody
    • Lysine K specific demethylase 6A antibody
    • Lysine specific demethylase 6A ubiquitously transcribed tetratricopeptide repeat gene X chromosome antibody
    • Lysine-specific demethylase 6A antibody
    • MGC141941 antibody
    • Ubiquitously transcribed tetratricopeptide repeat X chromosome antibody
    • Ubiquitously transcribed tetratricopeptide repeat protein X linked antibody
    • Ubiquitously transcribed TPR gene on the X chromosome antibody
    • Ubiquitously transcribed TPR protein on the X chromosome antibody
    • Ubiquitously transcribed X chromosome tetratricopeptide repeat protein antibody
    • Ubiquitously-transcribed TPR protein on the X chromosome antibody
    • Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein antibody
    • UTX antibody
    see all

Anti-KDM6A / UTX antibody images

  • Anti-KDM6A / UTX antibody (ab84190) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 154 kDa
    Observed band size : 168 kDa (why is the actual band size different from the predicted?)
    Additional bands at : <40 kDa. We are unsure as to the identity of these extra bands.

References for Anti-KDM6A / UTX antibody (ab84190)

ab84190 has not yet been referenced specifically in any publications.

Product Wall

Espero entonces tu respuesta. ¡Mucha suerte con las pruebas!

Gracias por tu colaboración y hasta pronto.

z tomado el tiempo para enviarnos los detalles e imágenes del protocolo.

Respecto a si el anticuerpo puede o no estar detectando las isoformas correspondientes a pesos moleculares alrededor de 100KDa, no tengo constancia de que as&iac...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"