Overview

  • Product name
  • Description
    Rabbit polyclonal to KGF
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide conjugated to KLH, corresponding to a region within internal sequence amino acids 64-94 of Human KGF (NP_002000.1).

  • Positive control
    • K562 cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at 4°C (up to 6 months). Store at -20°C long term.
  • Storage buffer
    Preservative: 0.09% Sodium Azide
    Constituents: PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab107406 is purified through a protein A column, followed by peptide affinity purification.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab107406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 23 kDa.

Target

  • Function
    Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
  • Tissue specificity
    Epithelial cell.
  • Sequence similarities
    Belongs to the heparin-binding growth factors family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Form
    Potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells.
  • Alternative names
    • FGF 7 antibody
    • FGF-7 antibody
    • Fgf7 antibody
    • FGF7_HUMAN antibody
    • Fibroblast growth factor 7 antibody
    • HBGF 7 antibody
    • HBGF-7 antibody
    • HBGF7 antibody
    • Heparin binding growth factor 7 antibody
    • Heparin-binding growth factor 7 antibody
    • Keratinocyte growth factor antibody
    • KGF antibody
    see all

Images

  • Anti-KGF antibody (ab107406) at 1/100 dilution + K562 cell lysate at 35 µg

    Predicted band size : 23 kDa

References

ab107406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your inquiry. The immunogen sequence for this antibody is: IRVRRLFCRTQWYLRIDKRGKVKGTQEMKNN This is according to the sequence data of human Keratinocyte growth factor (SwissProt ID P21781). I hope this information is helpful. Plea...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up