Overview

  • Product nameAnti-KIAA1024 antibody
    See all KIAA1024 primary antibodies
  • Description
    Rabbit polyclonal to KIAA1024
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 755-804 (DNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKA H) of Human KIAA1024 (NP_056021).

  • Positive control
    • Human fetal brain membrane lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab82753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 103 kDa (predicted molecular weight: 103 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-KIAA1024 antibody images

  • Anti-KIAA1024 antibody (ab82753) at 1 µg/ml + Fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 103 kDa
    Observed band size : 103 kDa

References for Anti-KIAA1024 antibody (ab82753)

ab82753 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"