
  • Product name
  • Description
    Rabbit polyclonal to KIAA1024
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 755-804 (DNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKA H) of Human KIAA1024 (NP_056021).

  • Positive control
    • Human fetal brain membrane lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab82753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 103 kDa (predicted molecular weight: 103 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-KIAA1024 antibody images

  • Anti-KIAA1024 antibody (ab82753) at 1 µg/ml + Fetal brain lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 103 kDa
    Observed band size : 103 kDa

References for Anti-KIAA1024 antibody (ab82753)

ab82753 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82753.
Please use the links above to contact us or submit feedback about this product.


Sign up