Overview

  • Product name
    Anti-KIAA1549 antibody
  • Description
    Rabbit polyclonal to KIAA1549
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 758-807 (

    QVPRTSGREPSAPSGNLPHRGLQGPGLGYPTSSTEDLQPGHSSASLIKAI

    ) of Human KIAA1549 (AAH38232).

  • Positive control
    • HepG2 cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Constituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab118721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 90 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Involvement in disease
    Note=A chromosomal aberration involving KIAA1549 is found in pilocytic astrocytoma. A tandem duplication of 2 Mb at 7q34 leads to the expression of a KIAA1549-BRAF fusion protein with a constitutive kinase activity and inducing cell transformation.
  • Sequence similarities
    Belongs to the UPF0606 family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • K1549_HUMAN antibody
    • KIAA1549 antibody
    • UPF0606 protein KIAA1549 antibody

Anti-KIAA1549 antibody images



  • Predicted band size : 90 kDa
    Western blot analysis of Mouse neurosphere lysate (30µg/lane) labeling KIAA159 with ab118721 at 1:1000. A HRP-conjugated anti-rabbit (1:5000) was used as the secondary antibody.
  • Anti-KIAA1549 antibody (ab118721) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 90 kDa
    6-18% SDS PAGE

References for Anti-KIAA1549 antibody (ab118721)

ab118721 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab118721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up