Anti-KIF24 antibody - C-terminal (ab178922)

Overview

  • Product name
    Anti-KIF24 antibody - C-terminal
    See all KIF24 primary antibodies
  • Description
    Rabbit polyclonal to KIF24 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human KIF24 aa 934-983 (C terminal). The exact sequence is proprietary.
    Sequence:

    SLAEKPYCSQVDFIYRQERGGGSSFDLRKDASQSEVSGENEGNLPSPEED


    Database link: Q5T7B8

  • Positive control
    • MDA-MB-435S whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 2% Sucrose, 98% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab178922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 152 kDa.

Target

  • Sequence similarities
    Belongs to the kinesin-like protein family.
    Contains 1 kinesin-motor domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links
  • Alternative names
    • bA571F15.4 antibody
    • C9orf48 antibody
    • Kif24 antibody
    • KIF24_HUMAN antibody
    • kinesin family member 24 antibody
    • Kinesin-like protein KIF24 antibody
    • RP11-571F15.7 antibody
    see all

Images

  • Anti-KIF24 antibody - C-terminal (ab178922) at 1 µg/ml + MDA-MB-435S whole cell lysate at 10 µg

    Predicted band size: 152 kDa



    Blocked in 5% milk.

References

ab178922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up