Overview

  • Product name
  • Description
    Rabbit polyclonal to KIF5B
  • Specificity
    This antibody is specific for KIF5B.
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human KIF5B aa 7-56.
    Sequence:

    CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST


    Database link: P33176

  • Positive control
    • Fetal brain lysate and human hepatocyte tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab42492 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 µg/ml.
WB Use a concentration of 0.5 µg/ml. Detects a band of approximately 110 kDa (predicted molecular weight: 110 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function
    Microtubule-dependent motor required for normal distribution of mitochondria and lysosomes.
  • Sequence similarities
    Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Kinesin subfamily.
    Contains 1 kinesin motor domain.
  • Domain
    Composed of three structural domains: a large globular N-terminal domain which is responsible for the motor activity of kinesin (it hydrolyzes ATP and binds microtubule), a central alpha-helical coiled coil domain that mediates the heavy chain dimerization; and a small globular C-terminal domain which interacts with other proteins (such as the kinesin light chains), vesicles and membranous organelles.
  • Cellular localization
    Cytoplasm, cytoskeleton. Uniformly distributed between soma and neurites in hippocampal neurons.
  • Information by UniProt
  • Database links
  • Alternative names
    • Conventional kinesin heavy chain antibody
    • KIF 5B antibody
    • KIF5B antibody
    • Kinesin 1 antibody
    • kinesin 1 (110-120kD) antibody
    • Kinesin 1 heavy chain antibody
    • Kinesin family member 5B antibody
    • Kinesin heavy chain antibody
    • kinesin, heavy chain, ubiquitous antibody
    • Kinesin-1 heavy chain antibody
    • Kinesin1 antibody
    • KINH antibody
    • KINH_HUMAN antibody
    • KNS 1 antibody
    • KNS antibody
    • KNS1 antibody
    • Ubiquitous kinesin heavy chain antibody
    • UKHC antibody
    see all

Images

  • Anti-KIF5B antibody (ab42492) at 1/100 dilution + fetal brain lysate

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 110 kDa
    Observed band size : 110 kDa
  • ab42492 at 4.0µg/ml, staining KIF5B in human hepatocytes.

    ab42492 at 4.0µg/ml, staining Kinesin heavy chain 5B in human hepatocytes.
  • ICC/IF image of ab42492 stained HepG2 cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab42492, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

References

This product has been referenced in:
  • Yi P  et al. KIF5B transports BNIP-2 to regulate p38 mitogen-activated protein kinase activation and myoblast differentiation. Mol Biol Cell 26:29-42 (2015). Read more (PubMed: 25378581) »
  • Cho JH  et al. Identification of the novel substrates for caspase-6 in apoptosis using proteomic approaches. BMB Rep 46:588-93 (2013). Read more (PubMed: 24195789) »

See all 4 Publications for this product

Customer reviews and Q&As

Abreviews
Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Loading amount
50 µg
Gel Running Conditions
Reduced Denaturing (4-12%)
Sample
Human Cell lysate - whole cell (Prostate cancer cell line)
Specification
Prostate cancer cell line
Treatment
siRNA - 48 hours
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Jun 04 2013

Vielen Dank für Ihre Anfrage.

Unser Labor hat bestätigt, das sich Kinesins in den Microtubuli befinden und somit die Färbung eine korrekte Lokalisation zeigt. Allerdings stimmen wir Ihnen auch zu, dass Kinesin eine punktuelle F...

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Human Cell lysate - whole cell (Prostate Cancer Line)
Loading amount
50 µg
Specification
Prostate Cancer Line
Gel Running Conditions
Reduced Denaturing
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Jul 23 2009

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (brain)
Specification
brain
Fixative
Formalin
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10mM citrate buffer pH6.0
Permeabilization
No
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 20°C
Username

Vlady Pavlova

Verified customer

Submitted Dec 11 2007

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up