Overview

  • Product name
  • Description
    Rabbit polyclonal to KIFC3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Cat, Dog, Orangutan
  • Immunogen

    Synthetic peptide within Human KIFC3 aa 786-833 (C terminal). The exact sequence is proprietary.
    Sequence:

    EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV


    Database link: Q9BVG8

  • Positive control
    • MCF7 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab80449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 93 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • Function
    Minus-end microtubule-dependent motor protein. Involved in apically targeted transport (By similarity). Required for zonula adherens maintenance.
  • Sequence similarities
    Belongs to the kinesin-like protein family.
    Contains 1 kinesin-motor domain.
  • Cellular localization
    Cell junction > adherens junction. Cytoplasm > cytoskeleton > centrosome. Cytoplasmic vesicle membrane. Apical cell membrane. On membrane organelles immediately beneath the apical plasma membrane of renal tubular epithelial cells. Localized in the distal tubules and loops of Henle in the kidney, but not in the proximal tubules or the glomeruli, with stronger staining in the apical area of these epithelial cells (By similarity). Localizes along zonula adherens only at mature cell-cell contacts.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp686D23201 antibody
    • FLJ34694 antibody
    • Kifc3 antibody
    • KIFC3_HUMAN antibody
    • Kinesin family member C3 antibody
    • Kinesin-like protein KIFC3 antibody
    see all

Images

  • Anti-KIFC3 antibody (ab80449) at 1 µg/ml + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 93 kDa
    Observed band size: 93 kDa
    Additional bands at: 36 kDa, 40 kDa, 48 kDa. We are unsure as to the identity of these extra bands.

References

ab80449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab80449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up