Overview

  • Product name
  • Description
    Rabbit polyclonal to Kindlin 2
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan
  • Immunogen

    Synthetic peptide within Human Kindlin 2 aa 175-225. The exact sequence is proprietary. (NP_006823.1)
    Sequence:

    SGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVS Q


    Database link: Q96AC1

  • Positive control
    • HeLa, 293T, Jurkat, mouse TCMK-1 and mouse NIH3T3 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab194967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 78 kDa.

Target

Images

  • All lanes : Anti-Kindlin 2 antibody (ab194967) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH/3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique

    Predicted band size : 78 kDa


    Exposure time : 30 seconds

    Cell lysates prepared using NETN lysis buffer.

  • Detection of Kindlin 2 in immunoprecipitates of 293T whole cell lysate (prepared using NETN lysis buffer; 1 mg for IP, 20% of IP loaded) using ab194967 at 6 µg/mg lysate for IP and at 0.1 µg/mL for subsequent Western blot detection.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab194967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up