Anti-IRK-2 antibody (ab121905)
Key features and details
- Rabbit polyclonal to IRK-2
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-IRK-2 antibody -
Description
Rabbit polyclonal to IRK-2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human IRK-2 aa 356-433.
Sequence:RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLS PQARHDFDRLQAGGGVLEQRPYRRESEI
-
Positive control
- Human kidney tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab121905 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
IHC-P
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. -
Sequence similarities
Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ12 subfamily. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 100131509 Human
- Entrez Gene: 100290070 Human
- Entrez Gene: 3768 Human
- Omim: 602323 Human
- SwissProt: Q14500 Human
- Unigene: 200629 Human
-
Alternative names
- ATP sensitive inward rectifier potassium channel 12 antibody
- ATP-sensitive inward rectifier potassium channel 12 antibody
- hIRK antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab121905 has not yet been referenced specifically in any publications.