Overview

  • Product name
  • Description
    Rabbit polyclonal to KIR2DL3
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KIR2DL3 aa 22-245. Extracellular domain.
    Sequence:

    HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLH LIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIV ITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRF SAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVT GNPSNSWPSPTEPSSETGNPRHLH


    Database link: P43628

  • Positive control
    • Human liver cell line extract.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 38 kDa.

Target

  • Function
    Receptor on natural killer (NK) cells for HLA-C alleles (HLA-Cw1, HLA-Cw3 and HLA-Cw7). Inhibits the activity of NK cells thus preventing cell lysis.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD158 antigen like family member B2 antibody
    • CD158 antigen-like family member B2 antibody
    • CD158b antibody
    • CD158b2 antibody
    • GL183 antibody
    • KI2L3_HUMAN antibody
    • Killer cell immunoglobulin like receptor two domains long cytoplasmic tail 3 antibody
    • Killer cell immunoglobulin-like receptor 2DL3 antibody
    • Killer inhibitory receptor cl 2-3 antibody
    • Killer inhibitory receptor CL2 3 antibody
    • KIR 023GB antibody
    • KIR-023GB antibody
    • KIR-K7b antibody
    • KIR-K7c antibody
    • KIR023GB antibody
    • KIR2DL3 antibody
    • KIR2DS5 antibody
    • KIRCL23 antibody
    • MHC class I NK cell receptor antibody
    • Natural killer associated transcript 2 antibody
    • Natural killer cell inhibitory receptor KIR2DL3 antibody
    • Natural killer-associated transcript 2 antibody
    • NKAT antibody
    • NKAT-2 antibody
    • NKAT2 antibody
    • NKAT2a antibody
    • NKAT2b antibody
    • p58 antibody
    • p58 natural killer cell receptor clone CL 6 antibody
    • p58 natural killer cell receptor clone CL-6 antibody
    • p58 NK Receptor antibody
    • p58 NK receptor CL 6 antibody
    • p58 NK receptor CL-6 antibody
    • p58.2 MHC class I specific NK receptor antibody
    • p58.2 MHC class-I-specific NK receptor antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of HepG2 cells using ab180803. Blue DAPI for nuclear staining.
  • Anti-KIR2DL3 antibody (ab180803) at 1/500 dilution + Human liver cell line extract

    Predicted band size : 38 kDa

References

ab180803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up