Overview

  • Product name
  • Description
    Rabbit polyclonal to KIR3DL1
  • Host species
    Rabbit
  • Specificity
    This antibody detects endogenous levels of KIR3DL1 protein.
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human KIR3DL1 aa 1-444.
    Sequence:

    MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCH YRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHP HSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMF EHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVT HTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSY DMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHS PYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVII LFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQ LDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP


    Database link: P43629

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab192586 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 49 kDa.

Target

  • Function
    Receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AMB11 antibody
    • CD158 antigen-like family member E antibody
    • CD158e antibody
    • CD158e antigen antibody
    • CD158E1 antibody
    • CD158E1/2 antibody
    • CD158E2 antibody
    • CL11 antibody
    • CL2 antibody
    • HLA-BW4-specific inhibitory NK cell receptor antibody
    • KI3L1_HUMAN antibody
    • killer cell immunoglobulin like receptor antibody
    • Killer cell immunoglobulin like receptor three domains , short cytoplasmic tail, 1 antibody
    • Killer cell immunoglobulin like receptor three domains long cytoplasmic tail 1 antibody
    • Killer cell immunoglobulin-like receptor 3DL1 antibody
    • KIR antibody
    • KIR antigen 3DL1 antibody
    • KIR G1 antibody
    • Kir3dl1 antibody
    • KIR3DS1 antibody
    • Kirl1 antibody
    • Kirl2 antibody
    • Krl1 antibody
    • MGC119726 antibody
    • MGC119728 antibody
    • MGC126589 antibody
    • MGC126591 antibody
    • MHC class I NK cell receptor antibody
    • Natural killer associated transcript 3 antibody
    • Natural killer cell inhibitory receptor antibody
    • Natural killer-associated transcript 3 antibody
    • NK receptor antibody
    • NK-associated transcript 10 antibody
    • NK-associated transcript 3 antibody
    • NK-associated transcript 3delIg1 antibody
    • NKAT-3 antibody
    • NKAT10 antibody
    • NKAT3 antibody
    • NKB1 antibody
    • NKB1B antibody
    • p70 killer cell inhibitory receptor antibody
    • p70 natural killer cell receptor clones CL 2/CL 11 antibody
    • p70 natural killer cell receptor clones CL-2/CL-11 antibody
    • p70 NK receptor CL-2/CL-11 antibody
    see all

References

ab192586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up