Overview

  • Product nameAnti-KIRREL2 antibody
    See all KIRREL2 primary antibodies
  • Description
    Rabbit polyclonal to KIRREL2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 71-120 (WSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVL V) of Human KIRREL2, (NP_115499)

  • Positive control
    • Fetal liver lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 75 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-KIRREL2 antibody images

  • Anti-KIRREL2 antibody (ab83014) at 1 µg/ml + Fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 75 kDa
    Observed band size : 64 kDa (why is the actual band size different from the predicted?)

References for Anti-KIRREL2 antibody (ab83014)

ab83014 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"