
  • Product nameAnti-KLF12 antibody
    See all KLF12 primary antibodies
  • Description
    Rabbit polyclonal to KLF12
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 72 - 121 (VDHFQTQTEPVDLSINKARTSPTAVSSSPVSMTASASSPSSTSTSSSSS S) of Human KLF12 (EAW80528).

  • Positive control
    • OVCAR-3 cell lysate


Associated products


Our Abpromise guarantee covers the use of ab90702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-KLF12 antibody images

  • Anti-KLF12 antibody (ab90702) at 1 µg/ml + OVCAR-3 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 44 kDa

References for Anti-KLF12 antibody (ab90702)

ab90702 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90702.
Please use the links above to contact us or submit feedback about this product.