Overview

  • Product name
    Anti-KLF9 antibody - N-terminal
    See all KLF9 primary antibodies
  • Description
    Rabbit polyclonal to KLF9 - N-terminal
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human KLF9 aa 38-87 (N terminal). The exact sequence is proprietary.
    Sequence:

    LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE


    Database link: Q13886

  • Positive control
    • Human fetal liver and Jurkat cell lysates; Human kidney and testis tissues

Properties

Applications

Our Abpromise guarantee covers the use of ab170980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 1 µg/ml. Predicted molecular weight: 27 kDa.
IHC-P Use a concentration of 4 - 8 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin embedded Human testis tissue labeling KLF9 with ab170980 antibody at 5 µg/ml.

  • Immunohistochemical analysis of paraffin embedded Human kidney tissue labeling KLF9 with ab170980 antibody at 5 µg/ml. Arrows indicate positively labelled epithelial cells of the renal tubule. Magnification: 400X.

  • Anti-KLF9 antibody - N-terminal (ab170980) at 0.20000000298 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size : 27 kDa
  • Anti-KLF9 antibody - N-terminal (ab170980) at 1 µg/ml + Human fetal liver lysate at 10 µg

    Predicted band size : 27 kDa

References

ab170980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up