Overview

  • Product nameAnti-KLHDC8B antibody
    See all KLHDC8B primary antibodies
  • Description
    Rabbit polyclonal to KLHDC8B
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within residues GCAMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSL corresponding to amino acids 215-264 of human KLHDC8B (NP_775817)

  • Positive control
    • Jurkat cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 37 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Involvement in diseaseDefects in KLHDC8B are a cause of Hodgkin lymphoma (HL) [MIM:236000]. A malignant disease characterized by progressive enlargement of the lymph nodes, spleen and general lymphoid tissue, and the presence of large, usually multinucleate, cells (Reed-Sternberg cells). Reed-Sternberg cells compose only 1-2% of the total tumor cell mass. The remainder is composed of a variety of reactive, mixed inflammatory cells consisting of lymphocytes, plasma cells, neutrophils, eosinophils and histiocytes. Note=A chromosomal aberration disrupting KLHDC8B has been found in a family with the nodular sclerosis type of classic Hodgkin lymphoma. Translocation t(2,3)(q11.2;p21.31).
  • Sequence similaritiesContains 8 Kelch repeats.
  • Developmental stageTranscribed predominantly during S phase, translated exclusively during mitosis and cytokinesis and rapidly degraded after cell division.
  • Cellular localizationCytoplasm. In mitotic cells, concentrates in the midbody of the cytoplasmic bridge linking daughter cells as they are about to separate during cytokinesis.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ11302 antibody
    • FP17659 antibody
    • Kelch domain containing 8B antibody
    • Kelch domain containing protein 8B antibody
    • Kelch domain-containing protein 8B antibody
    • KLD8B_HUMAN antibody
    • Klhdc8b antibody
    • MGC35097 antibody
    • MGC94736 antibody
    see all

Anti-KLHDC8B antibody images

  • Anti-KLHDC8B antibody (ab81060) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 37 kDa
    Observed band size : 37 kDa

References for Anti-KLHDC8B antibody (ab81060)

ab81060 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"